Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPA4QGM)

DOT Name CREB-binding protein (CREBBP)
Synonyms Histone lysine acetyltransferase CREBBP; EC 2.3.1.48; Protein-lysine acetyltransferase CREBBP; EC 2.3.1.-
Gene Name CREBBP
Related Disease
Rubinstein-Taybi syndrome ( )
Rubinstein-Taybi syndrome due to CREBBP mutations ( )
Menke-Hennekam syndrome 1 ( )
UniProt ID
CBP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1JSP ; 1LIQ ; 1RDT ; 1WO3 ; 1WO4 ; 1WO5 ; 1WO6 ; 1WO7 ; 1ZOQ ; 2D82 ; 2KJE ; 2KWF ; 2L84 ; 2L85 ; 2LXS ; 2LXT ; 2N1A ; 2RNY ; 3DWY ; 3P1C ; 3P1D ; 3P1E ; 3P1F ; 3SVH ; 4A9K ; 4N3W ; 4N4F ; 4NR4 ; 4NR5 ; 4NR6 ; 4NR7 ; 4NYV ; 4NYW ; 4NYX ; 4OUF ; 4TQN ; 4TS8 ; 4WHU ; 4YK0 ; 5CGP ; 5DBM ; 5EIC ; 5ENG ; 5EP7 ; 5GH9 ; 5H85 ; 5I83 ; 5I86 ; 5I89 ; 5I8B ; 5I8G ; 5J0D ; 5JEM ; 5KTU ; 5KTW ; 5KTX ; 5LPJ ; 5LPL ; 5MME ; 5MMG ; 5MPK ; 5MPN ; 5MPZ ; 5MQE ; 5MQG ; 5MQK ; 5NLK ; 5NRW ; 5NU3 ; 5OWK ; 5SVH ; 5TB6 ; 5W0E ; 5W0F ; 5W0L ; 5W0Q ; 5XXH ; 6ALB ; 6ALC ; 6AXQ ; 6AY3 ; 6AY5 ; 6DMK ; 6ES5 ; 6ES6 ; 6ES7 ; 6FQO ; 6FQT ; 6FQU ; 6FR0 ; 6FRF ; 6LQX ; 6M64 ; 6QST ; 6SQE ; 6SQF ; 6SQM ; 6SXX ; 6YIJ ; 6YIK ; 6YIL ; 6YIM ; 7CO1 ; 7EVJ ; 7JFL ; 7JFM ; 7JUO ; 7KPY ; 7RLE ; 7TB3 ; 7TBH ; 7WX2 ; 7XH6 ; 7XHE ; 7XI0 ; 7XIJ ; 7XM7 ; 7XNE ; 7XNG ; 8HAL ; 8HAM ; 8HAN
EC Number
2.3.1.-; 2.3.1.48
Pfam ID
PF00439 ; PF09030 ; PF08214 ; PF02172 ; PF06001 ; PF02135 ; PF00569
Sequence
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHT
NNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNS
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAG
MAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
Function
Acetylates histones, giving a specific tag for transcriptional activation. Mediates acetylation of histone H3 at 'Lys-18' and 'Lys-27' (H3K18ac and H3K27ac, respectively). Also acetylates non-histone proteins, like DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53 and FOXO1. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers. Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER). Acetylates POLR1E/PAF53, leading to decreased association of RNA polymerase I with the rDNA promoter region and coding region. Acetylates DDX21, thereby inhibiting DDX21 helicase activity. Acetylates FBL, preventing methylation of 'Gln-105' of histone H2A (H2AQ104me). Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway.
KEGG Pathway
Polycomb repressive complex (hsa03083 )
Viral life cycle - HIV-1 (hsa03250 )
cAMP sig.ling pathway (hsa04024 )
HIF-1 sig.ling pathway (hsa04066 )
FoxO sig.ling pathway (hsa04068 )
Cell cycle (hsa04110 )
Wnt sig.ling pathway (hsa04310 )
Notch sig.ling pathway (hsa04330 )
TGF-beta sig.ling pathway (hsa04350 )
Adherens junction (hsa04520 )
JAK-STAT sig.ling pathway (hsa04630 )
Long-term potentiation (hsa04720 )
Melanogenesis (hsa04916 )
Thyroid hormone sig.ling pathway (hsa04919 )
Glucagon sig.ling pathway (hsa04922 )
Growth hormone synthesis, secretion and action (hsa04935 )
Huntington disease (hsa05016 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Pathways in cancer (hsa05200 )
Viral carcinogenesis (hsa05203 )
MicroR.s in cancer (hsa05206 )
Re.l cell carcinoma (hsa05211 )
Prostate cancer (hsa05215 )
Reactome Pathway
RORA activates gene expression (R-HSA-1368082 )
BMAL1 (R-HSA-1368108 )
Pre-NOTCH Transcription and Translation (R-HSA-1912408 )
PPARA activates gene expression (R-HSA-1989781 )
Formation of the beta-catenin (R-HSA-201722 )
Regulation of gene expression in late stage (branching morphogenesis) pancreatic bud precursor cells (R-HSA-210744 )
NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )
Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 )
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 )
LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production (R-HSA-3134973 )
HATs acetylate histones (R-HSA-3214847 )
Attenuation phase (R-HSA-3371568 )
Notch-HLH transcription pathway (R-HSA-350054 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
SUMOylation of transcription cofactors (R-HSA-3899300 )
Regulation of lipid metabolism by PPARalpha (R-HSA-400206 )
Circadian Clock (R-HSA-400253 )
Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
CD209 (DC-SIGN) signaling (R-HSA-5621575 )
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release (R-HSA-6803204 )
Activation of the TFAP2 (AP-2) family of transcription factors (R-HSA-8866907 )
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells (R-HSA-8939246 )
RUNX3 regulates NOTCH signaling (R-HSA-8941856 )
NOTCH3 Intracellular Domain Regulates Transcription (R-HSA-9013508 )
NOTCH4 Intracellular Domain Regulates Transcription (R-HSA-9013695 )
Estrogen-dependent gene expression (R-HSA-9018519 )
TRAF3-dependent IRF activation pathway (R-HSA-918233 )
TRAF6 mediated IRF7 activation (R-HSA-933541 )
FOXO-mediated transcription of cell death genes (R-HSA-9614657 )
Regulation of FOXO transcriptional activity by acetylation (R-HSA-9617629 )
SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Heme signaling (R-HSA-9707616 )
Nuclear events mediated by NFE2L2 (R-HSA-9759194 )
NPAS4 regulates expression of target genes (R-HSA-9768919 )
Formation of paraxial mesoderm (R-HSA-9793380 )
NFE2L2 regulating inflammation associated genes (R-HSA-9818026 )
NFE2L2 regulating anti-oxidant/detoxification enzymes (R-HSA-9818027 )
NFE2L2 regulates pentose phosphate pathway genes (R-HSA-9818028 )
NFE2L2 regulating tumorigenic genes (R-HSA-9818030 )
NFE2L2 regulating MDR associated enzymes (R-HSA-9818032 )
NFE2L2 regulating ER-stress associated genes (R-HSA-9818035 )
Regulation of NFE2L2 gene expression (R-HSA-9818749 )
Zygotic genome activation (ZGA) (R-HSA-9819196 )
Regulation of gene expression by Hypoxia-inducible Factor (R-HSA-1234158 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Rubinstein-Taybi syndrome DISVF1HM Definitive Autosomal dominant [1]
Rubinstein-Taybi syndrome due to CREBBP mutations DISJGR7C Definitive Autosomal dominant [2]
Menke-Hennekam syndrome 1 DIS606L5 Strong Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Clofibrate DMPC1J7 Approved CREB-binding protein (CREBBP) affects the response to substance of Clofibrate. [35]
Ibrutinib DMHZCPO Approved CREB-binding protein (CREBBP) decreases the response to substance of Ibrutinib. [36]
IRX4204 DM9SCME Phase 1 CREB-binding protein (CREBBP) affects the response to substance of IRX4204. [35]
Ciglitazone DMAPO0T Preclinical CREB-binding protein (CREBBP) affects the response to substance of Ciglitazone. [35]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of CREB-binding protein (CREBBP). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of CREB-binding protein (CREBBP). [25]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of CREB-binding protein (CREBBP). [26]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of CREB-binding protein (CREBBP). [27]
Calyculin-A DMY29Q8 Investigative Calyculin-A increases the phosphorylation of CREB-binding protein (CREBBP). [34]
------------------------------------------------------------------------------------
28 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of CREB-binding protein (CREBBP). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of CREB-binding protein (CREBBP). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of CREB-binding protein (CREBBP). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of CREB-binding protein (CREBBP). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of CREB-binding protein (CREBBP). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of CREB-binding protein (CREBBP). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of CREB-binding protein (CREBBP). [10]
Testosterone DM7HUNW Approved Testosterone increases the expression of CREB-binding protein (CREBBP). [11]
Selenium DM25CGV Approved Selenium decreases the expression of CREB-binding protein (CREBBP). [12]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of CREB-binding protein (CREBBP). [13]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of CREB-binding protein (CREBBP). [14]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of CREB-binding protein (CREBBP). [15]
Aspirin DM672AH Approved Aspirin increases the expression of CREB-binding protein (CREBBP). [16]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of CREB-binding protein (CREBBP). [17]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of CREB-binding protein (CREBBP). [18]
Enzalutamide DMGL19D Approved Enzalutamide affects the expression of CREB-binding protein (CREBBP). [19]
Mitotane DMU1GX0 Approved Mitotane increases the activity of CREB-binding protein (CREBBP). [20]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of CREB-binding protein (CREBBP). [21]
Berberine DMC5Q8X Phase 4 Berberine increases the expression of CREB-binding protein (CREBBP). [22]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of CREB-binding protein (CREBBP). [23]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of CREB-binding protein (CREBBP). [24]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of CREB-binding protein (CREBBP). [12]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of CREB-binding protein (CREBBP). [28]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of CREB-binding protein (CREBBP). [29]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of CREB-binding protein (CREBBP). [30]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone decreases the expression of CREB-binding protein (CREBBP). [31]
Okadaic acid DM47CO1 Investigative Okadaic acid increases the expression of CREB-binding protein (CREBBP). [32]
4-ANDROSTENE-3-17-DIONE DMSE8NU Investigative 4-ANDROSTENE-3-17-DIONE increases the activity of CREB-binding protein (CREBBP). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 28 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
3 Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
4 Histone Acetyltransferase p300/CREB-binding Protein-associated Factor (PCAF) Is Required for All-trans-retinoic Acid-induced Granulocytic Differentiation in Leukemia Cells. J Biol Chem. 2017 Feb 17;292(7):2815-2829. doi: 10.1074/jbc.M116.745398. Epub 2017 Jan 4.
5 Cisplatin and doxorubicin repress Vascular Endothelial Growth Factor expression and differentially down-regulate Hypoxia-inducible Factor I activity in human ovarian cancer cells. Biochem Pharmacol. 2007 Jul 15;74(2):191-201. doi: 10.1016/j.bcp.2007.04.003. Epub 2007 Apr 6.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Arsenic exposure from drinking water is associated with decreased gene expression and increased DNA methylation in peripheral blood. Toxicol Appl Pharmacol. 2017 Apr 15;321:57-66. doi: 10.1016/j.taap.2017.02.019. Epub 2017 Feb 24.
9 Inhibition of prostate cancer cell colony formation by the flavonoid quercetin correlates with modulation of specific regulatory genes. Clin Diagn Lab Immunol. 2004 Jan;11(1):63-9. doi: 10.1128/cdli.11.1.63-69.2004.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 A pilot study on the transcriptional response of androgen- and insulin-related genes in peripheral blood mononuclear cells induced by testosterone administration in hypogonadal men. J Biol Regul Homeost Agents. 2011 Apr-Jun;25(2):291-4.
12 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
13 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
14 Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
15 Bortezomib and Arsenic Trioxide Activity on a Myelodysplastic Cell Line (P39): A Gene Expression Study. Turk J Haematol. 2015 Sep;32(3):206-12. doi: 10.4274/tjh.2014.0058.
16 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
17 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
18 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
19 NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
20 The organochlorine o,p'-DDT plays a role in coactivator-mediated MAPK crosstalk in MCF-7 breast cancer cells. Environ Health Perspect. 2012 Sep;120(9):1291-6. doi: 10.1289/ehp.1104296. Epub 2012 May 18.
21 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
22 Berberine acts as a putative epigenetic modulator by affecting the histone code. Toxicol In Vitro. 2016 Oct;36:10-17. doi: 10.1016/j.tiv.2016.06.004. Epub 2016 Jun 13.
23 Effects of resveratrol on the expression of a panel of genes interacting with the BRCA1 oncosuppressor in human breast cell lines. Clin Chim Acta. 2004 Jun;344(1-2):115-21. doi: 10.1016/j.cccn.2004.02.024.
24 Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
25 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
26 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
27 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
28 DON shares a similar mode of action as the ribotoxic stress inducer anisomycin while TBTO shares ER stress patterns with the ER stress inducer thapsigargin based on comparative gene expression profiling in Jurkat T cells. Toxicol Lett. 2014 Jan 30;224(3):395-406. doi: 10.1016/j.toxlet.2013.11.005. Epub 2013 Nov 15.
29 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
30 Integrated analysis of paraquat-induced microRNAs-mRNAs changes in human neural progenitor cells. Toxicol In Vitro. 2017 Oct;44:196-205. doi: 10.1016/j.tiv.2017.06.010. Epub 2017 Jun 12.
31 The androgen receptor co-activator CBP is up-regulated following androgen withdrawal and is highly expressed in advanced prostate cancer. J Pathol. 2004 Oct;204(2):159-66. doi: 10.1002/path.1609.
32 Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
33 ErbB receptor signaling and therapeutic resistance to aromatase inhibitors. Clin Cancer Res. 2006 Feb 1;12(3 Pt 2):1008s-1012s. doi: 10.1158/1078-0432.CCR-05-2352.
34 Calyculin A reveals serine/threonine phosphatase protein phosphatase 1 as a regulatory nodal point in canonical signal transducer and activator of transcription 3 signaling of human microvascular endothelial cells. J Interferon Cytokine Res. 2012 Feb;32(2):87-94. doi: 10.1089/jir.2011.0059. Epub 2011 Dec 5.
35 Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands. BMC Cancer. 2010 Nov 16;10:629. doi: 10.1186/1471-2407-10-629.
36 Synergistic activity of BET protein antagonist-based combinations in mantle cell lymphoma cells sensitive or resistant to ibrutinib. Blood. 2015 Sep 24;126(13):1565-74.