Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPEML48)

• DOT Name: Cytospin-B (SPECC1)
• Synonyms: Nuclear structure protein 5; NSP5; Sperm antigen HCMOGT-1; Sperm antigen with calponin homology and coiled-coil domains 1
• Gene Name: SPECC1
• Related Disease:
  Advanced cancer
  Alzheimer disease
  Bronchitis
  Carcinoid tumor
  Chronic myelomonocytic leukaemia
  Epithelial ovarian cancer
  facioscapulohumeral muscular dystrophy
  Frontometaphyseal dysplasia 1
  Hepatitis C virus infection
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Progressive supranuclear palsy
  Sarcoidosis
  Schizophrenia
  Severe acute respiratory syndrome (SARS)
  Small-cell lung cancer
  Breast cancer
  Breast carcinoma
  Estrogen resistance syndrome
  Colorectal cancer
  Colorectal carcinoma
  Gastric cancer
  Middle East Respiratory Syndrome (MERS)
  Stomach cancer
  Stroke
• UniProt ID: CYTSB_HUMAN
• Pfam ID: PF00307
• Sequence:
  MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLN
  KPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRTGIPAPREFSVTVSRERS
  VPRGPSNPRKSVSSPTSSNTPTPTKHLRTPSTKPKQENEGGEKAALESQVRELLAEAKAK
  DSEINRLRSELKKYKEKRTLNAEGTDALGPNVDGTSVSPGDTEPMIRALEEKNKNFQKEL
  SDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSDIDEY
  KKNIHGNALRTSGSSSSDVTKASLSPDASDFEHITAETPSRPLSSTSNPFKSSKCSTAGS
  SPNSVSELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT
  ILETSFHQHRERAEQLSQENEKLMNLLQERVKNEEPTTQEGKIIELEQKCTGILEQGRFE
  REKLLNIQQQLTCSLRKVEEENQGALEMIKRLKEENEKLNEFLELERHNNNMMAKTLEEC
  RVTLEGLKMENGSLKSHLQGEKQKATEASAVEQTAESCEVQEMLKVARAEKDLLELSCNE
  LRQELLKANGEIKHVSSLLAKVEKDYSYLKEICDHQAEQLSRTSLKLQEKASESDAEIKD
  MKETIFELEDQVEQHRAVKLHNNQLISELESSVIKLEEQKSDLERQLKTLTKQMKEETEE
  WRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNARLQKELGDVQGHGRVVTSR
  AAPPPVDEEPESSEVDAAGRWPGVCVSRTSPTPPESATTVKSLIKSFDLGRPGGAGQNIS
  VHKTPRSPLSGIPVRTAPAAAVSPMQRHSTYSSVRPASRGVTQRLDLPDLPLSDILKGRT
  ETLKPDPHLRKSPSLESLSRPPSLGFGDTRLLSASTRAWKPQSKLSVERKDPLAALAREY
  GGSKRNALLKWCQKKTQGYANIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEKK
  RNLLLAFEAAESVGIKPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
• Tissue Specificity: Highly expressed in testis. Barely detectable in other tissues. Also highly expressed in some cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[2]
Bronchitis	DISBM6EQ	Strong	Biomarker	[3]
Carcinoid tumor	DISMNRDC	Strong	Biomarker	[4]
Chronic myelomonocytic leukaemia	DISDN5P7	Strong	Biomarker	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[6]
facioscapulohumeral muscular dystrophy	DISSE0H0	Strong	Biomarker	[7]
Frontometaphyseal dysplasia 1	DIS2MB3L	Strong	Biomarker	[7]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[8]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[4]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[6]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[6]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[6]
Progressive supranuclear palsy	DISO5KRQ	Strong	Genetic Variation	[2]
Sarcoidosis	DISE5B8Z	Strong	Biomarker	[9]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[10]
Severe acute respiratory syndrome (SARS)	DISYW14W	Strong	Biomarker	[11]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Disputed	Biomarker	[12]
Breast carcinoma	DIS2UE88	Disputed	Biomarker	[12]
Estrogen resistance syndrome	DIS2SYXC	Disputed	Biomarker	[12]
Colorectal cancer	DISNH7P9	Limited	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[13]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[14]
Middle East Respiratory Syndrome (MERS)	DIS5VPYU	Limited	Biomarker	[15]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[14]
Stroke	DISX6UHX	Limited	Biomarker	[16]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cytospin-B (SPECC1).	[17]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cytospin-B (SPECC1).	[18]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cytospin-B (SPECC1).	[19]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cytospin-B (SPECC1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cytospin-B (SPECC1).	[21]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Cytospin-B (SPECC1).	[22]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Cytospin-B (SPECC1).	[22]
Marinol	DM70IK5	Approved	Marinol increases the expression of Cytospin-B (SPECC1).	[23]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cytospin-B (SPECC1).	[24]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Cytospin-B (SPECC1).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cytospin-B (SPECC1).	[26]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Cytospin-B (SPECC1).	[25]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Cytospin-B (SPECC1).	[27]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	1,6-hexamethylene diisocyanate increases the methylation of Cytospin-B (SPECC1).	[28]

References

• [1] Breast cancer screening: Impact on care pathways.Cancer Med. 2019 Jul;8(8):4070-4078. doi: 10.1002/cam4.2283. Epub 2019 Jun 6.
• [2] Tau pathology in the olfactory bulb correlates with Braak stage, Lewy body pathology and apolipoprotein epsilon4.Neuropathol Appl Neurobiol. 2003 Oct;29(5):503-10. doi: 10.1046/j.1365-2990.2003.00453.x.
• [3] Development and application of nsp5-ELISA for the detection of antibody to infectious bronchitis virus.J Virol Methods. 2017 May;243:182-189. doi: 10.1016/j.jviromet.2017.01.026. Epub 2017 Feb 20.
• [4] NSP-encoded reticulons are neuroendocrine markers of a novel category in human lung cancer diagnosis.Cancer Res. 1994 Sep 1;54(17):4769-76.
• [5] HCMOGT-1 is a novel fusion partner to PDGFRB in juvenile myelomonocytic leukemia with t(5;17)(q33;p11.2).Cancer Res. 2004 Apr 15;64(8):2649-51. doi: 10.1158/0008-5472.can-03-4026.
• [6] Upregulation of Circular RNA VPS13C-has-circ-001567 Promotes Ovarian Cancer Cell Proliferation and Invasion.Cancer Biother Radiopharm. 2019 Mar;34(2):110-118. doi: 10.1089/cbr.2018.2641. Epub 2018 Oct 30.
• [7] Development and validation of a foot-and-mouth disease virus SAT serotype-specific 3ABC assay to differentiate infected from vaccinated animals.J Virol Methods. 2018 May;255:44-51. doi: 10.1016/j.jviromet.2018.02.006. Epub 2018 Feb 8.
• [8] High risk injecting behaviour among people who inject pharmaceutical opioids in Australia.Int J Drug Policy. 2017 Apr;42:1-6. doi: 10.1016/j.drugpo.2016.12.004. Epub 2017 Jan 16.
• [9] Quantifying the relationship between symptoms at presentation and the prognosis of sarcoidosis.Respir Med. 2019 Jun;152:14-19. doi: 10.1016/j.rmed.2019.03.012. Epub 2019 Mar 23.
• [10] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [11] Variation analysis of the severe acute respiratory syndrome coronavirus putative non-structural protein 2 gene and construction of three-dimensional model.Chin Med J (Engl). 2005 May 5;118(9):707-13.
• [12] AND-34/BCAR3 differs from other NSP homologs in induction of anti-estrogen resistance, cyclin D1 promoter activation and altered breast cancer cell morphology.J Cell Physiol. 2007 Sep;212(3):655-65. doi: 10.1002/jcp.21059.
• [13] Meat, starch and non-starch polysaccharides, are epidemiological and experimental findings consistent with acquired genetic alterations in sporadic colorectal cancer?.Cancer Lett. 1997 Mar 19;114(1-2):25-34. doi: 10.1016/s0304-3835(97)04618-1.
• [14] Circ_SPECC1 enhances the inhibition of miR-526b on downstream KDM4A/YAP1 pathway to regulate the growth and invasion of gastric cancer cells.Biochem Biophys Res Commun. 2019 Sep 17;517(2):253-259. doi: 10.1016/j.bbrc.2019.07.065. Epub 2019 Jul 23.
• [15] Prediction and biochemical analysis of putative cleavage sites of the 3C-like protease of Middle East respiratory syndrome coronavirus.Virus Res. 2015 Oct 2;208:56-65. doi: 10.1016/j.virusres.2015.05.018. Epub 2015 May 31.
• [16] A novel free radical scavenger, NSP-116, ameliorated the brain injury in both ischemic and hemorrhagic stroke models.J Pharmacol Sci. 2019 Nov;141(3):119-126. doi: 10.1016/j.jphs.2019.09.012. Epub 2019 Oct 15.
• [17] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [18] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [19] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [20] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [23] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [26] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [27] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [28] DNA methylation modifies urine biomarker levels in 1,6-hexamethylene diisocyanate exposed workers: a pilot study. Toxicol Lett. 2014 Dec 1;231(2):217-26. doi: 10.1016/j.toxlet.2014.10.024. Epub 2014 Oct 22.