Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPY57X4)

DOT Name Testis-specific Y-encoded protein 1 (TSPY1)
Synonyms Cancer/testis antigen 78; CT78
Gene Name TSPY1
Related Disease
46,XY complete gonadal dysgenesis ( )
Adult germ cell tumor ( )
Alzheimer disease ( )
Azoospermia ( )
Breast cancer ( )
Breast carcinoma ( )
Complete androgen insensitivity syndrome ( )
Disorder of sexual differentiation ( )
Germ cell tumor ( )
Germ cell tumour ( )
Hematologic disease ( )
Hepatocellular carcinoma ( )
Hypogonadism ( )
Lung adenocarcinoma ( )
Malignant germ cell tumor ( )
Neoplasm ( )
Prader-Willi syndrome ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Seminoma ( )
Systemic sclerosis ( )
Testicular cancer ( )
Trichohepatoenteric syndrome ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
Advanced cancer ( )
Male infertility ( )
UniProt ID
TSPY1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00956
Sequence
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG
EEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELE
PVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDM
LSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPD
YEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTET
SGDSQLLS
Function May be involved in sperm differentiation and proliferation.
Tissue Specificity
Specifically expressed in testicular tissues. Isoform 1 and isoform 2 are expressed in spermatogonia and spermatocytes. Found in early testicular carcinoma in situ, spermatogonial cells in testicular tissues of 46,X,Y female and in prostate cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
46,XY complete gonadal dysgenesis DISLF3LT Strong Altered Expression [1]
Adult germ cell tumor DISJUCQ7 Strong Biomarker [2]
Alzheimer disease DISF8S70 Strong Biomarker [3]
Azoospermia DIS94181 Strong Altered Expression [4]
Breast cancer DIS7DPX1 Strong Biomarker [5]
Breast carcinoma DIS2UE88 Strong Biomarker [5]
Complete androgen insensitivity syndrome DISQL418 Strong Biomarker [1]
Disorder of sexual differentiation DISRMAEZ Strong Biomarker [1]
Germ cell tumor DIS62070 Strong Genetic Variation [6]
Germ cell tumour DISOF3TK Strong Biomarker [2]
Hematologic disease DIS9XD9A Strong Genetic Variation [7]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [8]
Hypogonadism DISICMNI Strong Biomarker [9]
Lung adenocarcinoma DISD51WR Strong Biomarker [10]
Malignant germ cell tumor DISTDR2M Strong Biomarker [11]
Neoplasm DISZKGEW Strong Genetic Variation [12]
Prader-Willi syndrome DISYWMLU Strong Biomarker [9]
Prostate cancer DISF190Y Strong Biomarker [13]
Prostate carcinoma DISMJPLE Strong Biomarker [13]
Prostate neoplasm DISHDKGQ Strong Genetic Variation [14]
Seminoma DIS3J8LJ Strong Altered Expression [15]
Systemic sclerosis DISF44L6 Strong Biomarker [16]
Testicular cancer DIS6HNYO Strong Biomarker [17]
Trichohepatoenteric syndrome DISL3ODF Strong Biomarker [18]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W moderate Altered Expression [19]
Liver cancer DISDE4BI moderate Altered Expression [19]
Advanced cancer DISAT1Z9 Limited Biomarker [10]
Male infertility DISY3YZZ Limited Genetic Variation [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 28 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Testis-specific Y-encoded protein 1 (TSPY1). [21]
------------------------------------------------------------------------------------

References

1 Gonadoblastoma Y locus genes expressed in germ cells of individuals with dysgenetic gonads and a Y chromosome in their karyotypes include DDX3Y and TSPY.Hum Reprod. 2019 Apr 1;34(4):770-779. doi: 10.1093/humrep/dez004.
2 Testis-specific protein Y-encoded gene is expressed in early and late stages of gonadoblastoma and testicular carcinoma in situ.Urol Oncol. 2007 Mar-Apr;25(2):141-6. doi: 10.1016/j.urolonc.2006.08.002.
3 Male microchimerism in the human female brain.PLoS One. 2012;7(9):e45592. doi: 10.1371/journal.pone.0045592. Epub 2012 Sep 26.
4 Molecular analysis of testis biopsy and semen pellet as complementary methods with histopathological analysis of testis in non-obstructive azoospermia.J Assist Reprod Genet. 2014 Jun;31(6):707-15. doi: 10.1007/s10815-014-0220-5. Epub 2014 Apr 12.
5 Fetal microchimerism in breast from women with and without breast cancer.Breast Cancer Res Treat. 2010 May;121(1):241-4. doi: 10.1007/s10549-009-0548-1. Epub 2009 Sep 19.
6 SRY mutation analysis by next generation (deep) sequencing in a cohort of chromosomal Disorders of Sex Development (DSD) patients with a mosaic karyotype.BMC Med Genet. 2012 Nov 16;13:108. doi: 10.1186/1471-2350-13-108.
7 Long-term persistence of hemopoietic chimerism following sex-mismatched bone marrow transplantation.Bone Marrow Transplant. 1997 Dec;20(11):969-73. doi: 10.1038/sj.bmt.1701011.
8 The Y-linked proto-oncogene TSPY contributes to poor prognosis of the male hepatocellular carcinoma patients by promoting the pro-oncogenic and suppressing the anti-oncogenic gene expression.Cell Biosci. 2019 Mar 4;9:22. doi: 10.1186/s13578-019-0287-x. eCollection 2019.
9 Characterization of breakpoints in the GABRG3 and TSPY genes in a family with a t(Y;15)(p11.2;q12).Am J Med Genet A. 2004 Mar 1;125A(2):177-80. doi: 10.1002/ajmg.a.20482.
10 Testis-specific protein, Y-linked 1 activates PI3K/AKT and RAS signaling pathways through suppressing IGFBP3 expression during tumor progression.Cancer Sci. 2019 May;110(5):1573-1586. doi: 10.1111/cas.13984. Epub 2019 Mar 25.
11 45,X/46,X,psu dic(Y) gonadal dysgenesis: influence of the two cell lines on the clinical phenotype, including gonadal histology.Sex Dev. 2013;7(6):282-8. doi: 10.1159/000356173. Epub 2013 Nov 13.
12 Ullrich-Turner Syndrome and Tumor Risk: Is There Another Chance to Early Gonadectomy in Positive TSPY and SRY Patients?.Eur J Pediatr Surg. 2016 Jun;26(3):273-6. doi: 10.1055/s-0035-1551568. Epub 2015 May 15.
13 Localization of candidate genes in a region of high frequency of microvariant alleles for prostate cancer susceptibility: the chromosome region Yp11.2 genetic variation.DNA Cell Biol. 2010 Jan;29(1):3-7. doi: 10.1089/dna.2009.0905.
14 Detection of recurrent copy number loss at Yp11.2 involving TSPY gene cluster in prostate cancer using array-based comparative genomic hybridization.Cancer Res. 2006 Apr 15;66(8):4055-64. doi: 10.1158/0008-5472.CAN-05-3822.
15 The Y-encoded TSPY protein: a significant marker potentially plays a role in the pathogenesis of testicular germ cell tumors.Hum Pathol. 2007 Oct;38(10):1470-81. doi: 10.1016/j.humpath.2007.03.011. Epub 2007 May 22.
16 Male microchimerism in women with systemic sclerosis and healthy women who have never given birth to a son.Ann Rheum Dis. 2005 Jun;64(6):845-8. doi: 10.1136/ard.2004.029314. Epub 2004 Nov 18.
17 TSPY is a cancer testis antigen expressed in human hepatocellular carcinoma.Br J Cancer. 2005 Aug 22;93(4):458-63. doi: 10.1038/sj.bjc.6602716.
18 Does the Y chromosome have a role in Mllerian aplasia?.Fertil Steril. 2010 Jun;94(1):120-5. doi: 10.1016/j.fertnstert.2009.02.004. Epub 2009 Mar 26.
19 TSPY potentiates cell proliferation and tumorigenesis by promoting cell cycle progression in HeLa and NIH3T3 cells.BMC Cancer. 2006 Jun 9;6:154. doi: 10.1186/1471-2407-6-154.
20 TSPY1 copy number variation influences spermatogenesis and shows differences among Y lineages.J Clin Endocrinol Metab. 2009 Oct;94(10):4016-22. doi: 10.1210/jc.2009-1029. Epub 2009 Sep 22.
21 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.