Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQQAEH4)

DOT Name RRP12-like protein (RRP12)
Gene Name RRP12
Related Disease
Bone osteosarcoma ( )
Osteosarcoma ( )
UniProt ID
RRP12_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7WTS; 7WTT; 7WTU; 7WTV; 7WTW; 7WTX; 7WTZ; 7WU0
Pfam ID
PF08161
Sequence
MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHN
ELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAA
HKEICAVLAAVTEVIRSQGGKETETEYFAALMTTMEAVESPESLAAVAYLLNLVLKRVPS
PVLIKKFSDTSKAFMDIMSAQASSGSTSVLRWVLSCLATLLRKQDLEAWGYPVTLQVYHG
LLSFTVHPKPKIRKAAQHGVCSVLKGSEFMFEKAPAHHPAAISTAKFCIQEIEKSGGSKE
ATTTLHMLTLLKDLLPCFPEGLVKSCSETLLRVMTLSHVLVTACAMQAFHSLFHARPGLS
TLSAELNAQIITALYDYVPSENDLQPLLAWLKVMEKAHINLVRLQWDLGLGHLPRFFGTA
VTCLLSPHSQVLTAATQSLKEILKECVAPHMADIGSVTSSASGPAQSVAKMFRAVEEGLT
YKFHAAWSSVLQLLCVFFEACGRQAHPVMRKCLQSLCDLRLSPHFPHTAALDQAVGAAVT
SMGPEVVLQAVPLEIDGSEETLDFPRSWLLPVIRDHVQETRLGFFTTYFLPLANTLKSKA
MDLAQAGSTVESKIYDTLQWQMWTLLPGFCTRPTDVAISFKGLARTLGMAISERPDLRVT
VCQALRTLITKGCQAEADRAEVSRFAKNFLPILFNLYGQPVAAGDTPAPRRAVLETIRTY
LTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYL
ESKAHGVQKKAYRVLEEVCASPQGPGALFVQSHLEDLKKTLLDSLRSTSSPAKRPRLKCL
LHIVRKLSAEHKEFITALIPEVILCTKEVSVGARKNAFALLVEMGHAFLRFGSNQEEALQ
CYLVLIYPGLVGAVTMVSCSILALTHLLFEFKGLMGTSTVEQLLENVCLLLASRTRDVVK
SALGFIKVAVTVMDVAHLAKHVQLVMEAIGKLSDDMRRHFRMKLRNLFTKFIRKFGFELV
KRLLPEEYHRVLVNIRKAEARAKRHRALSQAAVEEEEEEEEEEEPAQGKGDSIEEILADS
EDEEDNEEEERSRGKEQRKLARQRSRAWLKEGGGDEPLNFLDPKVAQRVLATQPGPGRGR
KKDHGFKVSADGRLIIREEADGNKMEEEEGAKGEDEEMADPMEDVIIRNKKHQKLKHQKE
AEEEELEIPPQYQAGGSGIHRPVAKKAMPGAEYKAKKAKGDVKKKGRPDPYAYIPLNRSK
LNRRKKMKLQGQFKGLVKAARRGSQVGHKNRRKDRRP
Tissue Specificity Weakly expressed. Expressed at intermediate level in testis and ovary.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bone osteosarcoma DIST1004 Limited Biomarker [1]
Osteosarcoma DISLQ7E2 Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
23 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of RRP12-like protein (RRP12). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of RRP12-like protein (RRP12). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of RRP12-like protein (RRP12). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of RRP12-like protein (RRP12). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of RRP12-like protein (RRP12). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of RRP12-like protein (RRP12). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of RRP12-like protein (RRP12). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of RRP12-like protein (RRP12). [9]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of RRP12-like protein (RRP12). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of RRP12-like protein (RRP12). [12]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of RRP12-like protein (RRP12). [13]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of RRP12-like protein (RRP12). [14]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the expression of RRP12-like protein (RRP12). [15]
Clodronate DM9Y6X7 Approved Clodronate decreases the expression of RRP12-like protein (RRP12). [15]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of RRP12-like protein (RRP12). [15]
Exemestane DM9HPW3 Approved Exemestane increases the expression of RRP12-like protein (RRP12). [16]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of RRP12-like protein (RRP12). [17]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of RRP12-like protein (RRP12). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of RRP12-like protein (RRP12). [19]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of RRP12-like protein (RRP12). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of RRP12-like protein (RRP12). [21]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of RRP12-like protein (RRP12). [22]
Forskolin DM6ITNG Investigative Forskolin increases the expression of RRP12-like protein (RRP12). [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 23 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of RRP12-like protein (RRP12). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of RRP12-like protein (RRP12). [18]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of RRP12-like protein (RRP12). [10]
------------------------------------------------------------------------------------

References

1 RRP12 is a crucial nucleolar protein that regulates p53 activity in osteosarcoma cells.Tumour Biol. 2016 Apr;37(4):4351-8. doi: 10.1007/s13277-015-4062-2. Epub 2015 Oct 23.
2 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
11 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
12 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
13 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
14 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
15 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
16 Effects of aromatase inhibitors on human osteoblast and osteoblast-like cells: a possible androgenic bone protective effects induced by exemestane. Bone. 2007 Apr;40(4):876-87. doi: 10.1016/j.bone.2006.11.029. Epub 2006 Dec 28.
17 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
18 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
19 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
20 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
21 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
22 Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.