Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRS4W4S)

• DOT Name: Serine/arginine-rich splicing factor 7 (SRSF7)
• Synonyms: Splicing factor 9G8; Splicing factor, arginine/serine-rich 7
• Gene Name: SRSF7
• Related Disease:
  Advanced cancer
  Gastric adenocarcinoma
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Schizophrenia
  Stomach cancer
• UniProt ID: SRSF7_HUMAN
• PDB ID: 2HVZ
• Pfam ID: PF00076
• Sequence:
  MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
  EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
  RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
  SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
• Function: Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific.
• Tissue Specificity: Brain, liver, kidney and lung.
• KEGG Pathway:
  Spliceosome (hsa03040)
  Amyotrophic lateral sclerosis (hsa05014)
  Herpes simplex virus 1 infection (hsa05168)
• Reactome Pathway:
  mRNA Splicing - Major Pathway (R-HSA-72163)
  mRNA Splicing - Minor Pathway (R-HSA-72165)
  mRNA 3'-end processing (R-HSA-72187)
  Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203)
  RNA Polymerase II Transcription Termination (R-HSA-73856)
  Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236)

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Gastric adenocarcinoma	DISWWLTC	Strong	Altered Expression	[2]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[2]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[3]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[2]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Serine/arginine-rich splicing factor 7 (SRSF7).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Serine/arginine-rich splicing factor 7 (SRSF7).	[24]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Serine/arginine-rich splicing factor 7 (SRSF7).	[25]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Serine/arginine-rich splicing factor 7 (SRSF7).	[27]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[12]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[13]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[14]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[15]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[16]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[17]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[18]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[19]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[20]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[21]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[22]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[15]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[26]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[30]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Serine/arginine-rich splicing factor 7 (SRSF7).	[31]

References

• [1] SRSF7 knockdown promotes apoptosis of colon and lung cancer cells.Oncol Lett. 2018 Apr;15(4):5545-5552. doi: 10.3892/ol.2018.8072. Epub 2018 Feb 16.
• [2] Comparative expression patterns and diagnostic efficacies of SR splicing factors and HNRNPA1 in gastric and colorectal cancer.BMC Cancer. 2016 Jun 10;16:358. doi: 10.1186/s12885-016-2387-x.
• [3] Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.Eur Arch Psychiatry Clin Neurosci. 2009 Apr;259(3):151-63. doi: 10.1007/s00406-008-0847-2. Epub 2009 Jan 22.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [6] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [12] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [13] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [14] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [15] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [16] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [17] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [18] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [19] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [20] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [23] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [28] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [29] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Identification of molecular signatures predicting the carcinogenicity of polycyclic aromatic hydrocarbons (PAHs). Toxicol Lett. 2012 Jul 7;212(1):18-28. doi: 10.1016/j.toxlet.2012.04.013. Epub 2012 May 1.