Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSPSIFO)

• DOT Name: Lymphocyte-specific protein 1 (LSP1)
• Synonyms: 47 kDa actin-binding protein; 52 kDa phosphoprotein; pp52; Lymphocyte-specific antigen WP34
• Gene Name: LSP1
• Related Disease:
  Astrocytoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiovascular disease
  Hepatocellular carcinoma
  High blood pressure
  Melanoma
  Nasopharyngeal carcinoma
  Non-hodgkin lymphoma
  Pancreatic adenocarcinoma
  Pneumonia
  Pneumonitis
  Thrombophilia
  Calcinosis
  Familial tumoral calcinosis
  Heart valve disorder
  Lung cancer
  Lung carcinoma
  Neoplasm
  Ulcerative colitis
  Rheumatoid arthritis
• UniProt ID: LSP1_HUMAN
• PDB ID: 3BH8; 4NO0; 4NO2
• Pfam ID: PF02029
• Sequence:
  MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
  QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
  GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
  LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
  AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
  GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
• Function: May play a role in mediating neutrophil activation and chemotaxis.
• Tissue Specificity: Activated T-lymphocytes.
• KEGG Pathway:
  C-type lectin receptor sig.ling pathway (hsa04625)
  Tuberculosis (hsa05152)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Astrocytoma	DISL3V18	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[2]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[3]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[4]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[5]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[6]
Melanoma	DIS1RRCY	Strong	Altered Expression	[7]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Genetic Variation	[8]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[9]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Biomarker	[10]
Pneumonia	DIS8EF3M	Strong	Biomarker	[11]
Pneumonitis	DIS88E0K	Strong	Biomarker	[11]
Thrombophilia	DISQR7U7	Strong	Altered Expression	[12]
Calcinosis	DISQP4OR	moderate	Biomarker	[13]
Familial tumoral calcinosis	DISYJZKG	moderate	Biomarker	[13]
Heart valve disorder	DIS84O7T	moderate	Biomarker	[13]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[14]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[14]
Neoplasm	DISZKGEW	moderate	Biomarker	[15]
Ulcerative colitis	DIS8K27O	moderate	Biomarker	[16]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[17]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Lymphocyte-specific protein 1 (LSP1).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Lymphocyte-specific protein 1 (LSP1).	[19]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Lymphocyte-specific protein 1 (LSP1).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Lymphocyte-specific protein 1 (LSP1).	[33]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Lymphocyte-specific protein 1 (LSP1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Lymphocyte-specific protein 1 (LSP1).	[21]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Lymphocyte-specific protein 1 (LSP1).	[23]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[24]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Lymphocyte-specific protein 1 (LSP1).	[25]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Lymphocyte-specific protein 1 (LSP1).	[26]
Selenium	DM25CGV	Approved	Selenium increases the expression of Lymphocyte-specific protein 1 (LSP1).	[27]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[28]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[29]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Lymphocyte-specific protein 1 (LSP1).	[30]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[31]
Nabiximols	DMHKJ5I	Phase 3	Nabiximols decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Lymphocyte-specific protein 1 (LSP1).	[28]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Lymphocyte-specific protein 1 (LSP1).	[35]

References

• [1] Cytomegalovirus-mediated induction of antisense mRNA expression to UL44 inhibits virus replication in an astrocytoma cell line: identification of an essential gene.J Virol. 1995 Apr;69(4):2047-57. doi: 10.1128/JVI.69.4.2047-2057.1995.
• [2] Genetic variants of ESR1 and SGSM3 are associated with the susceptibility of breast cancer in the Chinese population.Breast Cancer. 2017 May;24(3):369-374. doi: 10.1007/s12282-016-0712-5. Epub 2016 Jul 18.
• [3] Genome-wide association study identifies five new breast cancer susceptibility loci.Nat Genet. 2010 Jun;42(6):504-7. doi: 10.1038/ng.586. Epub 2010 May 9.
• [4] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [5] Lymphocyte-Specific Protein-1 Controls Sorafenib Sensitivity and Hepatocellular Proliferation through Extracellular Signal-Regulated Kinase1/2 Activation.Am J Pathol. 2018 Sep;188(9):2074-2086. doi: 10.1016/j.ajpath.2018.06.005. Epub 2018 Jul 3.
• [6] Interethnic analyses of blood pressure loci in populations of East Asian and European descent.Nat Commun. 2018 Nov 28;9(1):5052. doi: 10.1038/s41467-018-07345-0.
• [7] Lymphocyte-specific protein 1 expression in eukaryotic cells reproduces the morphologic and motile abnormality of NAD 47/89 neutrophils.Blood. 1998 Jun 15;91(12):4786-95.
• [8] A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
• [9] Pleiotropy of cancer susceptibility variants on the risk of non-Hodgkin lymphoma: the PAGE consortium.PLoS One. 2014 Mar 5;9(3):e89791. doi: 10.1371/journal.pone.0089791. eCollection 2014.
• [10] Association of breast cancer susceptibility variants with risk of pancreatic cancer.Cancer Epidemiol Biomarkers Prev. 2009 Nov;18(11):3044-8. doi: 10.1158/1055-9965.EPI-09-0306. Epub 2009 Oct 20.
• [11] Leukocyte-specific protein 1 regulates neutrophil recruitment in acute lung inflammation.Am J Physiol Lung Cell Mol Physiol. 2015 Nov 1;309(9):L995-1008. doi: 10.1152/ajplung.00068.2014. Epub 2015 Aug 28.
• [12] Physicochemical properties and anticoagulant activity of polyphenols derived from Lachnum singerianum.J Food Drug Anal. 2017 Oct;25(4):837-844. doi: 10.1016/j.jfda.2016.08.011. Epub 2016 Nov 11.
• [13] Raloxifene attenuates Gas6 and apoptosis in experimental aortic valve disease in renal failure.Am J Physiol Heart Circ Physiol. 2011 May;300(5):H1829-40. doi: 10.1152/ajpheart.00240.2010. Epub 2011 Feb 18.
• [14] Pleiotropic associations of risk variants identified for other cancers with lung cancer risk: the PAGE and TRICL consortia.J Natl Cancer Inst. 2014 Apr;106(4):dju061. doi: 10.1093/jnci/dju061. Epub 2014 Mar 28.
• [15] New Gene Profiling in Determination of Breast Cancer Recurrence and Prognosis in Iranian Women.Asian Pac J Cancer Prev. 2016;17(S3):155-60. doi: 10.7314/apjcp.2016.17.s3.155.
• [16] Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.Nat Genet. 2011 Mar;43(3):246-52. doi: 10.1038/ng.764. Epub 2011 Feb 6.
• [17] Leukocyte-specific protein 1 regulates T-cell migration in rheumatoid arthritis.Proc Natl Acad Sci U S A. 2015 Nov 24;112(47):E6535-43. doi: 10.1073/pnas.1514152112. Epub 2015 Nov 9.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [20] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [23] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [24] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [25] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [26] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [27] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [28] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [29] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [30] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [31] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [32] Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
• [33] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [34] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [35] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.