General Information of Drug Off-Target (DOT) (ID: OTSPSIFO)

DOT Name Lymphocyte-specific protein 1 (LSP1)
Synonyms 47 kDa actin-binding protein; 52 kDa phosphoprotein; pp52; Lymphocyte-specific antigen WP34
Gene Name LSP1
Related Disease
Astrocytoma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cardiovascular disease ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Melanoma ( )
Nasopharyngeal carcinoma ( )
Non-hodgkin lymphoma ( )
Pancreatic adenocarcinoma ( )
Pneumonia ( )
Pneumonitis ( )
Thrombophilia ( )
Calcinosis ( )
Familial tumoral calcinosis ( )
Heart valve disorder ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Ulcerative colitis ( )
Rheumatoid arthritis ( )
UniProt ID
LSP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3BH8; 4NO0; 4NO2
Pfam ID
PF02029
Sequence
MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
Function May play a role in mediating neutrophil activation and chemotaxis.
Tissue Specificity Activated T-lymphocytes.
KEGG Pathway
C-type lectin receptor sig.ling pathway (hsa04625 )
Tuberculosis (hsa05152 )

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Astrocytoma DISL3V18 Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Genetic Variation [2]
Breast carcinoma DIS2UE88 Strong Genetic Variation [2]
Breast neoplasm DISNGJLM Strong Biomarker [3]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [4]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [5]
High blood pressure DISY2OHH Strong Genetic Variation [6]
Melanoma DIS1RRCY Strong Altered Expression [7]
Nasopharyngeal carcinoma DISAOTQ0 Strong Genetic Variation [8]
Non-hodgkin lymphoma DISS2Y8A Strong Genetic Variation [9]
Pancreatic adenocarcinoma DISKHX7S Strong Biomarker [10]
Pneumonia DIS8EF3M Strong Biomarker [11]
Pneumonitis DIS88E0K Strong Biomarker [11]
Thrombophilia DISQR7U7 Strong Altered Expression [12]
Calcinosis DISQP4OR moderate Biomarker [13]
Familial tumoral calcinosis DISYJZKG moderate Biomarker [13]
Heart valve disorder DIS84O7T moderate Biomarker [13]
Lung cancer DISCM4YA moderate Genetic Variation [14]
Lung carcinoma DISTR26C moderate Genetic Variation [14]
Neoplasm DISZKGEW moderate Biomarker [15]
Ulcerative colitis DIS8K27O moderate Biomarker [16]
Rheumatoid arthritis DISTSB4J Limited Altered Expression [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Lymphocyte-specific protein 1 (LSP1). [18]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Lymphocyte-specific protein 1 (LSP1). [19]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Lymphocyte-specific protein 1 (LSP1). [22]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Lymphocyte-specific protein 1 (LSP1). [33]
------------------------------------------------------------------------------------
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Lymphocyte-specific protein 1 (LSP1). [20]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Lymphocyte-specific protein 1 (LSP1). [21]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Lymphocyte-specific protein 1 (LSP1). [23]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Lymphocyte-specific protein 1 (LSP1). [24]
Triclosan DMZUR4N Approved Triclosan increases the expression of Lymphocyte-specific protein 1 (LSP1). [25]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Lymphocyte-specific protein 1 (LSP1). [26]
Selenium DM25CGV Approved Selenium increases the expression of Lymphocyte-specific protein 1 (LSP1). [27]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Lymphocyte-specific protein 1 (LSP1). [28]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Lymphocyte-specific protein 1 (LSP1). [29]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Lymphocyte-specific protein 1 (LSP1). [30]
Seocalcitol DMKL9QO Phase 3 Seocalcitol decreases the expression of Lymphocyte-specific protein 1 (LSP1). [31]
Nabiximols DMHKJ5I Phase 3 Nabiximols decreases the expression of Lymphocyte-specific protein 1 (LSP1). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Lymphocyte-specific protein 1 (LSP1). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Lymphocyte-specific protein 1 (LSP1). [28]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Lymphocyte-specific protein 1 (LSP1). [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)

References

1 Cytomegalovirus-mediated induction of antisense mRNA expression to UL44 inhibits virus replication in an astrocytoma cell line: identification of an essential gene.J Virol. 1995 Apr;69(4):2047-57. doi: 10.1128/JVI.69.4.2047-2057.1995.
2 Genetic variants of ESR1 and SGSM3 are associated with the susceptibility of breast cancer in the Chinese population.Breast Cancer. 2017 May;24(3):369-374. doi: 10.1007/s12282-016-0712-5. Epub 2016 Jul 18.
3 Genome-wide association study identifies five new breast cancer susceptibility loci.Nat Genet. 2010 Jun;42(6):504-7. doi: 10.1038/ng.586. Epub 2010 May 9.
4 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
5 Lymphocyte-Specific Protein-1 Controls Sorafenib Sensitivity and Hepatocellular Proliferation through Extracellular Signal-Regulated Kinase1/2 Activation.Am J Pathol. 2018 Sep;188(9):2074-2086. doi: 10.1016/j.ajpath.2018.06.005. Epub 2018 Jul 3.
6 Interethnic analyses of blood pressure loci in populations of East Asian and European descent.Nat Commun. 2018 Nov 28;9(1):5052. doi: 10.1038/s41467-018-07345-0.
7 Lymphocyte-specific protein 1 expression in eukaryotic cells reproduces the morphologic and motile abnormality of NAD 47/89 neutrophils.Blood. 1998 Jun 15;91(12):4786-95.
8 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
9 Pleiotropy of cancer susceptibility variants on the risk of non-Hodgkin lymphoma: the PAGE consortium.PLoS One. 2014 Mar 5;9(3):e89791. doi: 10.1371/journal.pone.0089791. eCollection 2014.
10 Association of breast cancer susceptibility variants with risk of pancreatic cancer.Cancer Epidemiol Biomarkers Prev. 2009 Nov;18(11):3044-8. doi: 10.1158/1055-9965.EPI-09-0306. Epub 2009 Oct 20.
11 Leukocyte-specific protein 1 regulates neutrophil recruitment in acute lung inflammation.Am J Physiol Lung Cell Mol Physiol. 2015 Nov 1;309(9):L995-1008. doi: 10.1152/ajplung.00068.2014. Epub 2015 Aug 28.
12 Physicochemical properties and anticoagulant activity of polyphenols derived from Lachnum singerianum.J Food Drug Anal. 2017 Oct;25(4):837-844. doi: 10.1016/j.jfda.2016.08.011. Epub 2016 Nov 11.
13 Raloxifene attenuates Gas6 and apoptosis in experimental aortic valve disease in renal failure.Am J Physiol Heart Circ Physiol. 2011 May;300(5):H1829-40. doi: 10.1152/ajpheart.00240.2010. Epub 2011 Feb 18.
14 Pleiotropic associations of risk variants identified for other cancers with lung cancer risk: the PAGE and TRICL consortia.J Natl Cancer Inst. 2014 Apr;106(4):dju061. doi: 10.1093/jnci/dju061. Epub 2014 Mar 28.
15 New Gene Profiling in Determination of Breast Cancer Recurrence and Prognosis in Iranian Women.Asian Pac J Cancer Prev. 2016;17(S3):155-60. doi: 10.7314/apjcp.2016.17.s3.155.
16 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.Nat Genet. 2011 Mar;43(3):246-52. doi: 10.1038/ng.764. Epub 2011 Feb 6.
17 Leukocyte-specific protein 1 regulates T-cell migration in rheumatoid arthritis.Proc Natl Acad Sci U S A. 2015 Nov 24;112(47):E6535-43. doi: 10.1073/pnas.1514152112. Epub 2015 Nov 9.
18 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
19 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
20 Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
21 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
22 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
23 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
24 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
25 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
26 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
27 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
28 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
29 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
30 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
31 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
32 Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
33 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
34 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
35 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.