Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUJ93MN)

• DOT Name: Glutathione S-transferase omega-1 (GSTO1)
• Synonyms: GSTO-1; EC 2.5.1.18; Glutathione S-transferase omega 1-1; GSTO 1-1; Glutathione-dependent dehydroascorbate reductase; EC 1.8.5.1; Monomethylarsonic acid reductase; MMA(V) reductase; EC 1.20.4.2; S-(Phenacyl)glutathione reductase; SPG-R
• Gene Name: GSTO1
• UniProt ID: GSTO1_HUMAN
• PDB ID: 1EEM; 3LFL; 3VLN; 4IS0; 4YQM; 4YQU; 4YQV; 5UEH; 5V3Q; 5YVN; 5YVO; 6MHB; 6MHC; 6MHD; 6PNM; 6PNN; 6PNO
• EC Number: 1.20.4.2; 1.8.5.1; 2.5.1.18
• Pfam ID: PF14497 ; PF13409
• Sequence:
  MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
  EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
  SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
  FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
  L
• Function: Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
• Tissue Specificity: Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung.
• KEGG Pathway:
  Glutathione metabolism (hsa00480)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Metabolic pathways (hsa01100)
  Platinum drug resistance (hsa01524)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - D. adducts (hsa05204)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Hepatocellular carcinoma (hsa05225)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Glutathione conjugation (R-HSA-156590)
  Vitamin C (ascorbate) metabolism (R-HSA-196836)
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)
  Methylation (R-HSA-156581)
• BioCyc Pathway: MetaCyc:HS07564-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Glutathione S-transferase omega-1 (GSTO1) increases the response to substance of Arsenic.	[27]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Glutathione S-transferase omega-1 (GSTO1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[9]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[11]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Glutathione S-transferase omega-1 (GSTO1).	[12]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[13]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[14]
Cocaine	DMSOX7I	Approved	Cocaine affects the expression of Glutathione S-transferase omega-1 (GSTO1).	[15]
Phenytoin	DMNOKBV	Approved	Phenytoin decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[16]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[17]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[18]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[20]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[4]
MG-132	DMKA2YS	Preclinical	MG-132 increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[21]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[22]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[23]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[25]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Glutathione S-transferase omega-1 (GSTO1).	[26]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[21]
ROSMARINIC ACID	DMQ6SJT	Investigative	ROSMARINIC ACID increases the expression of Glutathione S-transferase omega-1 (GSTO1).	[17]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [5] Identification of novel biomarkers for doxorubicin-induced toxicity in human cardiomyocytes derived from pluripotent stem cells. Toxicology. 2015 Feb 3;328:102-11. doi: 10.1016/j.tox.2014.12.018. Epub 2014 Dec 18.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Downregulation of glutathione S-transferase M1 protein in N-butyl-N-(4-hydroxybutyl)nitrosamine-induced mouse bladder carcinogenesis. Toxicol Appl Pharmacol. 2014 Sep 15;279(3):322-330.
• [12] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [13] DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
• [14] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [15] Proteomic analysis of the nucleus accumbens of rats with different vulnerability to cocaine addiction. Neuropharmacology. 2009 Jul;57(1):41-8. doi: 10.1016/j.neuropharm.2009.04.005. Epub 2009 Apr 22.
• [16] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [17] Identification of lead-produced lipid hydroperoxides in human HepG2 cells and protection using rosmarinic and ascorbic acids with a reference to their regulatory roles on Nrf2-Keap1 antioxidant pathway. Chem Biol Interact. 2019 Dec 1;314:108847. doi: 10.1016/j.cbi.2019.108847. Epub 2019 Oct 11.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Differential effects of arsenic species on Nrf2 and Bach1 nuclear localization in cultured hepatocytes. Toxicol Appl Pharmacol. 2021 Feb 15;413:115404. doi: 10.1016/j.taap.2021.115404. Epub 2021 Jan 9.
• [22] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [23] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [24] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [27] Association between arsenic metabolism gene polymorphisms and arsenic-induced skin lesions in individuals exposed to high-dose inorganic arsenic in northwest China. Sci Rep. 2018 Jan 11;8(1):413. doi: 10.1038/s41598-017-18925-3.