Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUS3SIQ)

• DOT Name: Uncharacterized protein C6orf141 (C6ORF141)
• Gene Name: C6ORF141
• Related Disease:
  Advanced cancer
  Neoplasm
  Oral cancer
• UniProt ID: CF141_HUMAN
• Sequence:
  MNDPFARMETRGPQGAANPMDSSRSLGDLGPFPREVGRGAPLAPGARNPATAGASRSQGG
  GHEDRTADRALGPRAGEELDRESWVREKVLFLLHPERWLGTRGDPAREEVAGAEDLPHAG
  GEDHGEEPNYPSVFQRQKRISGRRVAPPRDAADPPKYVLVRVEDYQVTQEVLQTSWAKGR
  MTTRTEEHFVTALTFRSSREGQPGERWGPAESRALQARTGASRVHAAGRRVSPSPGTWLE
  EIKL

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Oral cancer	DISLD42D	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Uncharacterized protein C6orf141 (C6ORF141).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Uncharacterized protein C6orf141 (C6ORF141).	[12]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[7]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[8]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Uncharacterized protein C6orf141 (C6ORF141).	[9]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[7]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[10]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[7]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[13]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Uncharacterized protein C6orf141 (C6ORF141).	[15]

References

• [1] Low C6orf141 Expression is Significantly Associated with a Poor Prognosis in Patients with Oral Cancer.Sci Rep. 2019 Mar 14;9(1):4520. doi: 10.1038/s41598-019-41194-1.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [9] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [10] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [11] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Loss of TRIM33 causes resistance to BET bromodomain inhibitors through MYC- and TGF-beta-dependent mechanisms. Proc Natl Acad Sci U S A. 2016 Aug 2;113(31):E4558-66.
• [14] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [15] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.