Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVQLYIY)

• DOT Name: Matrix-remodeling-associated protein 7 (MXRA7)
• Gene Name: MXRA7
• Related Disease:
  Corneal disease
  Corneal infection
  Corneal neovascularization
  Psoriasis
• UniProt ID: MXRA7_HUMAN
• Sequence:
  MEAPAELLAALPALATALALLLAWLLVRRGAAASPEPARAPPEPAPPAEATGAPAPSRPC
  APEPAASPAGPEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEARQEEEQDL
  DGEKGPSSEGPEEEDGEGFSFKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLM
  KDNKETFGEMSDGDVQEQLRLYDM

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Corneal disease	DISTUIM1	Strong	Biomarker	[1]
Corneal infection	DISN2KPA	Strong	Altered Expression	[1]
Corneal neovascularization	DISKOGZP	Strong	Altered Expression	[1]
Psoriasis	DIS59VMN	Strong	Biomarker	[2]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[11]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[12]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[13]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[12]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[17]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[12]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[18]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Matrix-remodeling-associated protein 7 (MXRA7).	[19]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Matrix-remodeling-associated protein 7 (MXRA7).	[8]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Matrix-remodeling-associated protein 7 (MXRA7).	[16]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Matrix-remodeling-associated protein 7 (MXRA7).	[16]

References

• [1] Public data mining plus domestic experimental study defined involvement of the old-yet-uncharacterized gene matrix-remodeling associated 7 (MXRA7) in physiopathology of the eye.Gene. 2017 Oct 20;632:43-49. doi: 10.1016/j.gene.2017.08.018. Epub 2017 Aug 26.
• [2] Altered expression of matrix remodelling associated 7 (MXRA7) in psoriatic epidermis: Evidence for a protective role in the psoriasis imiquimod mouse model.Exp Dermatol. 2018 Sep;27(9):1038-1042. doi: 10.1111/exd.13687.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [11] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [14] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [15] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [16] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [17] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [18] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [19] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.