Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW5WCX9)

DOT Name	Coiled-coil domain-containing protein 54 (CCDC54)
Synonyms	Testis development protein NYD-SP17
Gene Name	CCDC54
Related Disease	Cervical cancer ( ) Cervical carcinoma ( ) Endometrial cancer ( ) Breast cancer ( ) Breast carcinoma ( ) Breast neoplasm ( ) Carcinoma of esophagus ( ) Clear cell adenocarcinoma ( ) Epithelial ovarian cancer ( ) Esophageal squamous cell carcinoma ( ) Head-neck squamous cell carcinoma ( ) Malignant uterine tumour ( ) Myelodysplastic syndrome ( ) Neoplasm of esophagus ( ) Neoplasm of testis ( ) Non-small-cell lung cancer ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Pituitary tumor ( ) Plasma cell myeloma ( ) Severe combined immunodeficiency ( ) Testicular cancer ( ) Triple negative breast cancer ( ) Advanced cancer ( ) Endometrial carcinoma ( ) Esophageal cancer ( ) Lung cancer ( ) Lung carcinoma ( )
UniProt ID	CCD54_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTSDDCNQDDDSY DGKMNLPVVLQDVKTAQVELFSQMTDIVHMIPKVQEKTDLYQKQMEVLETRMNVNEDKQC TTTKDILSMKEDIKALKKKVTELEIQNSCSTIHCLEILEGERGKEITELLYKLIQPATLK NTLASTDMEISSAEPEKVPSYPKSTDHLEKKTISPQMKTLKKRNHQNASRSFEKAKPNIY IYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPTILPEEPQVITQRYCPFTGPI LSLTTICLSIFNNIYGFICSLKEEVTRL

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cervical cancer	DISFSHPF	Definitive	Biomarker	[1]
Cervical carcinoma	DIST4S00	Definitive	Biomarker	[1]
Endometrial cancer	DISW0LMR	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[2]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[2]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[3]
Clear cell adenocarcinoma	DISYUGHZ	Strong	Altered Expression	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[5]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[3]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[6]
Malignant uterine tumour	DIS3QDT8	Strong	Biomarker	[7]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[8]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[3]
Neoplasm of testis	DISK4XHT	Strong	Biomarker	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[6]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[5]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[5]
Pituitary tumor	DISN67JD	Strong	Biomarker	[10]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[6]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Biomarker	[11]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[12]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[4]
Endometrial carcinoma	DISXR5CY	moderate	Altered Expression	[7]
Esophageal cancer	DISGB2VN	Limited	Altered Expression	[2]
Lung cancer	DISCM4YA	Limited	Biomarker	[13]
Lung carcinoma	DISTR26C	Limited	Biomarker	[13]
------------------------------------------------------------------------------------


⏷ Show the Full List of 28 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Coiled-coil domain-containing protein 54 (CCDC54).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 54 (CCDC54).	[15]
------------------------------------------------------------------------------------

References

1	Sperm protein 17 is highly expressed in endometrial and cervical cancers.BMC Cancer. 2010 Aug 16;10:429. doi: 10.1186/1471-2407-10-429.
2	Cancer testis antigen Sperm Protein 17 as a new target for triple negative breast cancer immunotherapy.Oncotarget. 2017 Aug 10;8(43):74378-74390. doi: 10.18632/oncotarget.20102. eCollection 2017 Sep 26.
3	Clinical significance of sperm protein 17 expression and immunogenicity in esophageal cancer.Int J Cancer. 2007 Apr 15;120(8):1739-47. doi: 10.1002/ijc.22463.
4	Validity and prognostic significance of sperm protein 17 as a tumor biomarker for epithelial ovarian cancer: a retrospective study.BMC Cancer. 2018 Oct 11;18(1):970. doi: 10.1186/s12885-018-4880-x.
5	Development of a M cell-targeted microparticulate platform, BSK02? for oral immunization against the ovarian cancer antigen, sperm protein 17.J Biomed Mater Res B Appl Biomater. 2019 Jan;107(1):29-36. doi: 10.1002/jbm.b.34092. Epub 2018 Mar 4.
6	The cancer-testis antigen, sperm protein 17, a new biomarker and immunological target in head and neck squamous cell carcinoma.Oncotarget. 2017 Oct 31;8(59):100280-100287. doi: 10.18632/oncotarget.22213. eCollection 2017 Nov 21.
7	In Vitro Assessment of the Expression and T Cell Immunogenicity of the Tumor-Associated Antigens BORIS, MUC1, hTERT, MAGE-A3 and Sp17 in Uterine Cancer.Int J Mol Sci. 2016 Sep 9;17(9):1525. doi: 10.3390/ijms17091525.
8	Decitabine treatment sensitizes tumor cells to T-cell-mediated cytotoxicity in patients with myelodysplastic syndromes.Am J Transl Res. 2017 Feb 15;9(2):454-465. eCollection 2017.
9	Cancer immunotherapy targeting Sp17: when should the laboratory findings be translated to the clinics?.Am J Hematol. 2005 Sep;80(1):6-11. doi: 10.1002/ajh.20415.
10	Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.Oncotarget. 2015 Feb 20;6(5):2812-26. doi: 10.18632/oncotarget.2802.
11	A NOD/SCID tumor model for human ovarian cancer that allows tracking of tumor progression through the biomarker Sp17.J Immunol Methods. 2007 Apr 10;321(1-2):86-93. doi: 10.1016/j.jim.2007.01.010. Epub 2007 Feb 9.
12	Cancer-testis antigens as biomarkers for Merkel cell carcinoma: Pitfalls and opportunities.J Cutan Pathol. 2019 Oct;46(10):748-752. doi: 10.1111/cup.13528. Epub 2019 Jul 11.
13	Umbilical cord blood-derived dendritic cells infected by adenovirus for SP17 expression induce antigen-specific cytotoxic T cells against NSCLC cells.Cell Immunol. 2015 Nov-Dec;298(1-2):18-24. doi: 10.1016/j.cellimm.2015.08.004. Epub 2015 Aug 18.
14	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
15	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.