Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWD33K1)

• DOT Name: N-myc proto-oncogene protein (MYCN)
• Synonyms: Class E basic helix-loop-helix protein 37; bHLHe37
• Gene Name: MYCN
• Related Disease: Feingold syndrome type 1
• UniProt ID: MYCN_HUMAN
• PDB ID: 5G1X; 7ZTL
• Pfam ID: PF00010 ; PF01056
• Sequence:
  MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
  LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
  SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
  HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
  GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
  VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
  SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
  VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
• Function: Positively regulates the transcription of MYCNOS in neuroblastoma cells.
• Tissue Specificity: Expressed in the neuronal cells of the cerebrum, neuroblastomas and thyroid tumors (at protein level).
• KEGG Pathway: Transcriptio.l misregulation in cancer (hsa05202)
• Reactome Pathway: Signaling by ALK (R-HSA-201556)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Feingold syndrome type 1	DIS2QY8I	Definitive	Autosomal dominant	[1]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	N-myc proto-oncogene protein (MYCN) decreases the response to substance of Doxorubicin.	[29]
Etoposide	DMNH3PG	Approved	N-myc proto-oncogene protein (MYCN) decreases the response to substance of Etoposide.	[29]
Vismodegib	DM5IXKQ	Approved	N-myc proto-oncogene protein (MYCN) decreases the response to substance of Vismodegib.	[30]
LDE225	DMM9F25	Phase 2	N-myc proto-oncogene protein (MYCN) decreases the response to substance of LDE225.	[30]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of N-myc proto-oncogene protein (MYCN).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of N-myc proto-oncogene protein (MYCN).	[19]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of N-myc proto-oncogene protein (MYCN).	[25]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of N-myc proto-oncogene protein (MYCN).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of N-myc proto-oncogene protein (MYCN).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of N-myc proto-oncogene protein (MYCN).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of N-myc proto-oncogene protein (MYCN).	[6]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of N-myc proto-oncogene protein (MYCN).	[7]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of N-myc proto-oncogene protein (MYCN).	[6]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of N-myc proto-oncogene protein (MYCN).	[8]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of N-myc proto-oncogene protein (MYCN).	[9]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of N-myc proto-oncogene protein (MYCN).	[10]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of N-myc proto-oncogene protein (MYCN).	[11]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of N-myc proto-oncogene protein (MYCN).	[12]
LY2835219	DM93VBZ	Approved	LY2835219 decreases the expression of N-myc proto-oncogene protein (MYCN).	[13]
Pantothenic acid	DM091H2	Approved	Pantothenic acid increases the expression of N-myc proto-oncogene protein (MYCN).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of N-myc proto-oncogene protein (MYCN).	[6]
Crocin	DM5F24X	Phase 3	Crocin decreases the expression of N-myc proto-oncogene protein (MYCN).	[16]
MLN8237	DMO8PT9	Phase 3	MLN8237 decreases the expression of N-myc proto-oncogene protein (MYCN).	[17]
CPI-0610	DMPXOYJ	Phase 3	CPI-0610 decreases the expression of N-myc proto-oncogene protein (MYCN).	[15]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of N-myc proto-oncogene protein (MYCN).	[18]
INCB057643	DMG65CV	Phase 1/2	INCB057643 decreases the expression of N-myc proto-oncogene protein (MYCN).	[15]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of N-myc proto-oncogene protein (MYCN).	[20]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of N-myc proto-oncogene protein (MYCN).	[15]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of N-myc proto-oncogene protein (MYCN).	[21]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of N-myc proto-oncogene protein (MYCN).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of N-myc proto-oncogene protein (MYCN).	[23]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of N-myc proto-oncogene protein (MYCN).	[24]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of N-myc proto-oncogene protein (MYCN).	[26]
tryptanthrin	DMTRYCI	Investigative	tryptanthrin decreases the expression of N-myc proto-oncogene protein (MYCN).	[27]
Torin2	DMC6U93	Investigative	Torin2 decreases the expression of N-myc proto-oncogene protein (MYCN).	[28]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Emetine	DMCT2YF	Approved	Emetine increases the degradation of N-myc proto-oncogene protein (MYCN).	[15]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] All-trans-retinoic acid inhibits collapsin response mediator protein-2 transcriptional activity during SH-SY5Y neuroblastoma cell differentiation. FEBS J. 2007 Jan;274(2):498-511. doi: 10.1111/j.1742-4658.2006.05597.x.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] [Impact of arsenic trioxide on proliferation and metastasis of drug-resistant human ovarian carcinoma cell line]. Ai Zheng. 2002 Aug;21(8):863-7.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [9] Role of miRNA in the regulation of cannabidiol-mediated apoptosis in neuroblastoma cells. Oncotarget. 2019 Jan 1;10(1):45-59. doi: 10.18632/oncotarget.26534. eCollection 2019 Jan 1.
• [10] Molecular targeting of retinoic acid metabolism in neuroblastoma: the role of the CYP26 inhibitor R116010 in vitro and in vivo. Br J Cancer. 2007 Jun 4;96(11):1675-83.
• [11] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [12] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [13] Biological specificity of CDK4/6 inhibitors: dose response relationship, in vivo signaling, and composite response signature. Oncotarget. 2017 Jul 4;8(27):43678-43691. doi: 10.18632/oncotarget.18435.
• [14] Calcium pantothenate modulates gene expression in proliferating human dermal fibroblasts. Exp Dermatol. 2009 Nov;18(11):969-78. doi: 10.1111/j.1600-0625.2009.00884.x. Epub 2009 Apr 8.
• [15] IGF2BP1 induces neuroblastoma via a druggable feedforward loop with MYCN promoting 17q oncogene expression. Mol Cancer. 2023 May 29;22(1):88. doi: 10.1186/s12943-023-01792-0.
• [16] Crocin inhibits proliferation and induces apoptosis through suppressing MYCN expression in retinoblastoma. J Biochem Mol Toxicol. 2019 May;33(5):e22292. doi: 10.1002/jbt.22292. Epub 2019 Jan 23.
• [17] A Cre-conditional MYCN-driven neuroblastoma mouse model as an improved tool for preclinical studies. Oncogene. 2015 Jun;34(26):3357-68. doi: 10.1038/onc.2014.269. Epub 2014 Sep 1.
• [18] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [21] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [22] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [23] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [26] Histone deacetylase 2 and N-Myc reduce p53 protein phosphorylation at serine 46 by repressing gene transcription of tumor protein 53-induced nuclear protein 1. Oncotarget. 2014 Jun 30;5(12):4257-68. doi: 10.18632/oncotarget.1991.
• [27] Tryptanthrin induces growth inhibition and neuronal differentiation in the human neuroblastoma LA-N-1 cells. Chem Biol Interact. 2013 Apr 25;203(2):512-21. doi: 10.1016/j.cbi.2013.03.001. Epub 2013 Mar 13.
• [28] The ALK(F1174L) mutation potentiates the oncogenic activity of MYCN in neuroblastoma. Cancer Cell. 2012 Jul 10;22(1):117-30. doi: 10.1016/j.ccr.2012.06.001.
• [29] Altered expression of the MYCN oncogene modulates MRP gene expression and response to cytotoxic drugs in neuroblastoma cells. Oncogene. 1999 Apr 29;18(17):2777-82. doi: 10.1038/sj.onc.1202859.
• [30] Epigenetic targeting of Hedgehog pathway transcriptional output through BET bromodomain inhibition. Nat Med. 2014 Jul;20(7):732-40. doi: 10.1038/nm.3613. Epub 2014 Jun 29.