General Information of Drug Off-Target (DOT) (ID: OTX007YL)

DOT Name Neutrophil cytosol factor 4 (NCF4)
Synonyms NCF-4; Neutrophil NADPH oxidase factor 4; SH3 and PX domain-containing protein 4; p40-phox; p40phox
Gene Name NCF4
Related Disease
Advanced cancer ( )
Autoimmune disease ( )
Colorectal carcinoma ( )
Cystic fibrosis ( )
Granulomatous disease, chronic, autosomal recessive, cytochrome b-positive, type 3 ( )
Granulomatous disease, chronic, X-linked ( )
Lymphoma, non-Hodgkin, familial ( )
Non-hodgkin lymphoma ( )
Pneumonia ( )
Pneumonitis ( )
Rheumatoid arthritis ( )
Immune system disorder ( )
Chronic granulomatous disease ( )
Cardiac disease ( )
Inflammatory bowel disease ( )
UniProt ID
NCF4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1H6H; 1OEY; 1W6X; 1W70; 1Z9Q; 2DYB
Pfam ID
PF00564 ; PF00787 ; PF00018
Sequence
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Function
Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
Tissue Specificity Expression is restricted to hematopoietic cells.
KEGG Pathway
Phagosome (hsa04145 )
Osteoclast differentiation (hsa04380 )
Neutrophil extracellular trap formation (hsa04613 )
Leukocyte transendothelial migration (hsa04670 )
Prion disease (hsa05020 )
Leishmaniasis (hsa05140 )
Diabetic cardiomyopathy (hsa05415 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Cross-presentation of particulate exogenous antigens (phagosomes) (R-HSA-1236973 )
Detoxification of Reactive Oxygen Species (R-HSA-3299685 )
VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
RHO GTPases Activate NADPH Oxidases (R-HSA-5668599 )
RAC1 GTPase cycle (R-HSA-9013149 )
RAC2 GTPase cycle (R-HSA-9013404 )
RAC3 GTPase cycle (R-HSA-9013423 )
ROS and RNS production in phagocytes (R-HSA-1222556 )

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
Autoimmune disease DISORMTM Strong Genetic Variation [2]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [3]
Cystic fibrosis DIS2OK1Q Strong Biomarker [4]
Granulomatous disease, chronic, autosomal recessive, cytochrome b-positive, type 3 DIS3RJK7 Strong Autosomal recessive [5]
Granulomatous disease, chronic, X-linked DISNTTS3 Strong Genetic Variation [6]
Lymphoma, non-Hodgkin, familial DISCXYIZ Strong Genetic Variation [7]
Non-hodgkin lymphoma DISS2Y8A Strong Genetic Variation [7]
Pneumonia DIS8EF3M Strong Biomarker [8]
Pneumonitis DIS88E0K Strong Biomarker [8]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [2]
Immune system disorder DISAEGPH moderate Biomarker [9]
Chronic granulomatous disease DIS9ZR24 Supportive Autosomal recessive [10]
Cardiac disease DISVO1I5 Limited Biomarker [11]
Inflammatory bowel disease DISGN23E Limited Genetic Variation [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Neutrophil cytosol factor 4 (NCF4). [13]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Neutrophil cytosol factor 4 (NCF4). [14]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Neutrophil cytosol factor 4 (NCF4). [15]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Neutrophil cytosol factor 4 (NCF4). [16]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Neutrophil cytosol factor 4 (NCF4). [17]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Neutrophil cytosol factor 4 (NCF4). [18]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Neutrophil cytosol factor 4 (NCF4). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Cell-Surface Integrins and CAR Are Both Essential for Adenovirus Type 5 Transduction of Canine Cells of Lymphocytic Origin.PLoS One. 2017 Jan 9;12(1):e0169532. doi: 10.1371/journal.pone.0169532. eCollection 2017.
2 A case-control study of rheumatoid arthritis identifies an associated single nucleotide polymorphism in the NCF4 gene, supporting a role for the NADPH-oxidase complex in autoimmunity.Arthritis Res Ther. 2007;9(5):R98. doi: 10.1186/ar2299.
3 Germline variation in NCF4, an innate immunity gene, is associated with an increased risk of colorectal cancer.Int J Cancer. 2014 Mar 15;134(6):1399-407. doi: 10.1002/ijc.28457. Epub 2013 Nov 14.
4 Ineffective correction of PPAR signaling in cystic fibrosis airway epithelial cells undergoing repair.Int J Biochem Cell Biol. 2016 Sep;78:361-369. doi: 10.1016/j.biocel.2016.07.035. Epub 2016 Jul 30.
5 Neutrophils from p40phox-/- mice exhibit severe defects in NADPH oxidase regulation and oxidant-dependent bacterial killing. J Exp Med. 2006 Aug 7;203(8):1927-37. doi: 10.1084/jem.20052069. Epub 2006 Jul 31.
6 Chronic granulamatous disease: Two decades of experience from a paediatric immunology unit in a country with high rate of consangineous marriages.Scand J Immunol. 2019 Feb;89(2):e12737. doi: 10.1111/sji.12737. Epub 2019 Jan 23.
7 Genetic polymorphisms in oxidative stress-related genes are associated with outcomes following treatment for aggressive B-cell non-Hodgkin lymphoma.Am J Hematol. 2014 Jun;89(6):639-45. doi: 10.1002/ajh.23709. Epub 2014 Apr 12.
8 Fibrous nanocellulose, crystalline nanocellulose, carbon nanotubes, and crocidolite asbestos elicit disparate immune responses upon pharyngeal aspiration in mice.J Immunotoxicol. 2018 Dec;15(1):12-23. doi: 10.1080/1547691X.2017.1414339.
9 Genetic disorders coupled to ROS deficiency.Redox Biol. 2015 Dec;6:135-156. doi: 10.1016/j.redox.2015.07.009. Epub 2015 Jul 17.
10 Chronic Granulomatous Disease. 2012 Aug 9 [updated 2022 Apr 21]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
11 NAD(P)H oxidase and multidrug resistance protein genetic polymorphisms are associated with doxorubicin-induced cardiotoxicity. Circulation. 2005 Dec 13;112(24):3754-62.
12 Association between NCF4 rs4821544T/C polymorphism and inflammatory bowel disease risk in Caucasian: a meta-analysis.Inflamm Res. 2015 Oct;64(10):825-31. doi: 10.1007/s00011-015-0866-1. Epub 2015 Aug 20.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
15 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
16 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
17 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
18 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
19 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.