Details of the Drug

General Information of Drug (ID: DMBUH26)

Drug Name
Rituximab
Synonyms MAbThera (TN)
Indication
Disease Entry ICD 11 Status REF
Non-hodgkin lymphoma 2B33.5 Approved [1], [2]
Haematological malignancy 2B33.Y Phase 1 [1], [2]
Therapeutic Class
Anticancer Agents
Drug Type
Antibody
Sequence
>heavy chain chimeric
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain chimeric
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Cross-matching ID
DrugBank ID
DB00073
TTD ID
D09EXD
VARIDT ID
DR00421

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Leukocyte surface antigen Leu-16 (CD20) TTUE541 CD20_HUMAN Not Available [3], [4]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Rituximab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Rituximab and Roflumilast. Asthma [CA23] [14]
Denosumab DMNI0KO Moderate Additive myelosuppressive effects by the combination of Rituximab and Denosumab. Low bone mass disorder [FB83] [15]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Rituximab and Cladribine. Mature B-cell leukaemia [2A82] [14]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Rituximab and Alemtuzumab. Mature B-cell leukaemia [2A82] [16]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Rituximab and Tecfidera. Multiple sclerosis [8A40] [17]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Rituximab and Siponimod. Multiple sclerosis [8A40] [18]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Rituximab and Fingolimod. Multiple sclerosis [8A40] [19]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Rituximab and Ocrelizumab. Multiple sclerosis [8A40] [20]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Rituximab and Ozanimod. Multiple sclerosis [8A40] [14]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Rituximab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [21]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Rituximab and Efalizumab. Psoriasis [EA90] [22]
Upadacitinib DM32B5U Major Additive immunosuppressive effects by the combination of Rituximab and Upadacitinib. Rheumatoid arthritis [FA20] [14]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Rituximab and Canakinumab. Rheumatoid arthritis [FA20] [23]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Rituximab and Rilonacept. Rheumatoid arthritis [FA20] [23]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Rituximab and Golimumab. Rheumatoid arthritis [FA20] [24]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Rituximab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [25]
Azathioprine DMMZSXQ Moderate Additive myelosuppressive effects by the combination of Rituximab and Azathioprine. Transplant rejection [NE84] [18]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Rituximab and Ganciclovir. Virus infection [1A24-1D9Z] [18]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Rituximab and Valganciclovir. Virus infection [1A24-1D9Z] [18]
⏷ Show the Full List of 19 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6780).
2 Disease-modifying agents for multiple sclerosis: recent advances and future prospects. Drugs. 2008;68(17):2445-68.
3 [Contribution of radioimmunotherapy to the treatment of lymphoma]. Ann Pharm Fr. 2008 Nov-Dec;66(5-6):300-8.
4 Knockouts model the 100 best-selling drugs--will they model the next 100 Nat Rev Drug Discov. 2003 Jan;2(1):38-51.
5 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
6 Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20. Mol Immunol. 2009 Jul;46(11-12):2419-23.
7 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2628).
8 Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
9 Clinical pipeline report, company report or official report of Genentech (2009).
10 Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
11 Clinical pipeline report, company report or official report of Roche (2009).
12 Mitigating the risk of cytokine release syndrome in a Phase I trial of CD20/CD3 bispecific antibody mosunetuzumab in NHL: impact of translational system modeling. NPJ Syst Biol Appl. 2020 Aug 28;6(1):28.
13 Clinical pipeline report, company report or official report of Genmab.
14 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
15 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
16 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
17 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
18 Cerner Multum, Inc. "Australian Product Information.".
19 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
20 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
21 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
22 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
23 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
24 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
25 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]