Details of the Drug

General Information of Drug (ID: DMCKL5V)

Drug Name

Efalizumab

Synonyms

Raptiva; Raptiva (TN); Efalizumab (USAN/INN)

Indication

Disease Entry	ICD 11	Status	REF
Psoriasis vulgaris	EA90	Approved	[1], [2]
Renal transplantation	NE84	Phase 2	[1], [2]

Therapeutic Class

Immunomodulatory Agents

Drug Type

Antibody

Sequence

>heavy chain variable region
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGIMIHPSDSETR
YNQKFKDIRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARIGIYFYGTTYFDYIWGQGTL
VTVSS
>light chain variable region
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWXQQKPGKAPKLLIYSGSTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKR

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 5 days [3]

Cross-matching ID

DrugBank ID: DB00095
TTD ID: D03SGR

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Integrin alpha-L (ITGAL)	TT48WR6	ITAL_HUMAN	Not Available	[4]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Psoriasis vulgaris

ICD Disease Classification

EA90

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Integrin alpha-L (ITGAL)	DTT	ITGAL	1.20E-33	0.79	2.12

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Efalizumab

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Brodalumab	DMASDQ6	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Brodalumab.	Psoriasis [EA90]	[12]
Ustekinumab	DMHTYK3	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Ustekinumab.	Psoriasis [EA90]	[12]
Tildrakizumab	DMLW9HG	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Tildrakizumab.	Psoriasis [EA90]	[12]
Risankizumab	DMM32GT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Risankizumab.	Psoriasis [EA90]	[12]
Ixekizumab	DMXW92T	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Ixekizumab.	Psoriasis [EA90]	[12]
-----------

Coadministration of a Drug Treating the Disease Different from Efalizumab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Thioguanine	DM7NKEV	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Thioguanine.	Acute myeloid leukaemia [2A60]	[12]
Midostaurin	DMI6E0R	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Midostaurin.	Acute myeloid leukaemia [2A60]	[12]
Idarubicin	DMM0XGL	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Idarubicin.	Acute myeloid leukaemia [2A60]	[12]
Daunorubicin	DMQUSBT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Daunorubicin.	Acute myeloid leukaemia [2A60]	[12]
Siltuximab	DMGEATB	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Siltuximab.	Anemia [3A00-3A9Z]	[12]
Budesonide	DMJIBAW	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Budesonide.	Asthma [CA23]	[12]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Roflumilast.	Asthma [CA23]	[13]
Dupilumab	DMOAD2Y	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Dupilumab.	Atopic eczema [EA80]	[12]
Linezolid	DMGFPU2	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Linezolid.	Bacterial infection [1A00-1C4Z]	[12]
Temozolomide	DMKECZD	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Temozolomide.	Brain cancer [2A00]	[12]
Lomustine	DMMWSUL	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Lomustine.	Brain cancer [2A00]	[12]
Eribulin	DM1DX4Q	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Eribulin.	Breast cancer [2C60-2C6Y]	[12]
Talazoparib	DM1KS78	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Talazoparib.	Breast cancer [2C60-2C6Y]	[12]
Ixabepilone	DM2OZ3G	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Ixabepilone.	Breast cancer [2C60-2C6Y]	[12]
LY2835219	DM93VBZ	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and LY2835219.	Breast cancer [2C60-2C6Y]	[12]
Pralatrexate	DMAO80I	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Pralatrexate.	Breast cancer [2C60-2C6Y]	[12]
Palbociclib	DMD7L94	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Palbociclib.	Breast cancer [2C60-2C6Y]	[12]
Mitomycin	DMH0ZJE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Mitomycin.	Breast cancer [2C60-2C6Y]	[12]
Thiotepa	DMIZKOP	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Thiotepa.	Breast cancer [2C60-2C6Y]	[12]
Cabazitaxel	DMPAZHC	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Cabazitaxel.	Breast cancer [2C60-2C6Y]	[12]
Bosutinib	DMTI8YE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Bosutinib.	Breast cancer [2C60-2C6Y]	[12]
Corticotropin	DMP9TWZ	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Corticotropin.	Chronic kidney disease [GB61]	[12]
Irinotecan	DMP6SC2	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Irinotecan.	Colorectal cancer [2B91]	[12]
Oxaliplatin	DMQNWRD	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Oxaliplatin.	Colorectal cancer [2B91]	[12]
Aflibercept	DMT3D5I	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Aflibercept.	Colorectal cancer [2B91]	[12]
Capecitabine	DMTS85L	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Capecitabine.	Colorectal cancer [2B91]	[12]
Mycophenolic acid	DMU65NK	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Mycophenolic acid.	Crohn disease [DD70]	[12]
Polatuzumab vedotin	DMF6Y0L	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[12]
Axicabtagene ciloleucel	DMYHN59	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Axicabtagene ciloleucel.	Diffuse large B-cell lymphoma [2A81]	[12]
Bay 80-6946	DMLOS5R	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Bay 80-6946.	Follicular lymphoma [2A80]	[12]
Avapritinib	DMK2GZX	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[12]
177Lu-DOTATATE	DMT8GVU	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[12]
Procarbazine	DMIK367	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Procarbazine.	Hodgkin lymphoma [2B30]	[12]
Bleomycin	DMNER5S	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Bleomycin.	Hodgkin lymphoma [2B30]	[12]
Brentuximab vedotin	DMWLC57	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[12]
Zidovudine	DM4KI7O	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Zidovudine.	Human immunodeficiency virus disease [1C60-1C62]	[12]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Efalizumab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[14]
Fludrocortisone	DMUDIR8	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Fludrocortisone.	Hypo-osmolality/hyponatraemia [5C72]	[12]
Olaratumab	DMNYOIX	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Olaratumab.	Kaposi sarcoma [2B57]	[12]
Methotrexate	DM2TEOL	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Methotrexate.	Leukaemia [2A60-2B33]	[12]
Nelarabine	DMB6VEG	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Nelarabine.	Leukaemia [2A60-2B33]	[12]
DTI-015	DMXZRW0	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and DTI-015.	Liver cancer [2C12]	[12]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Denosumab.	Low bone mass disorder [FB83]	[15]
Brigatinib	DM7W94S	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Brigatinib.	Lung cancer [2C25]	[12]
Lurbinectedin	DMEFRTZ	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Lurbinectedin.	Lung cancer [2C25]	[12]
Osimertinib	DMRJLAT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Osimertinib.	Lung cancer [2C25]	[12]
Belimumab	DM3OBQF	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Belimumab.	Lupus erythematosus [4A40]	[12]
Inotuzumab ozogamicin	DMAC130	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Inotuzumab ozogamicin.	Malignant haematopoietic neoplasm [2B33]	[12]
Fludarabine	DMVRLT7	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Fludarabine.	Malignant haematopoietic neoplasm [2B33]	[12]
Ofatumumab	DM295PR	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Ofatumumab.	Mature B-cell leukaemia [2A82]	[12]
Obinutuzumab	DM3BVAE	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Obinutuzumab.	Mature B-cell leukaemia [2A82]	[12]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Efalizumab and Cladribine.	Mature B-cell leukaemia [2A82]	[13]
Idelalisib	DM602WT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Idelalisib.	Mature B-cell leukaemia [2A82]	[12]
GDC-0199	DMH0QKA	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and GDC-0199.	Mature B-cell leukaemia [2A82]	[12]
Chlorambucil	DMRKE63	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Chlorambucil.	Mature B-cell leukaemia [2A82]	[12]
IPI-145	DMWA24P	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and IPI-145.	Mature B-cell leukaemia [2A82]	[12]
Acalabrutinib	DM7GCVW	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[12]
Clofarabine	DMCVJ86	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Clofarabine.	Mature B-cell lymphoma [2A85]	[12]
Blinatumomab	DMGECIJ	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Blinatumomab.	Mature B-cell lymphoma [2A85]	[12]
Ibrutinib	DMHZCPO	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Ibrutinib.	Mature B-cell lymphoma [2A85]	[12]
Vincristine	DMINOX3	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Vincristine.	Mature B-cell lymphoma [2A85]	[12]
Teniposide	DMLW57T	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Teniposide.	Mature B-cell lymphoma [2A85]	[12]
Tisagenlecleucel	DMM9BJD	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Tisagenlecleucel.	Mature B-cell lymphoma [2A85]	[12]
Mercaptopurine	DMTM2IK	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Mercaptopurine.	Mature B-cell lymphoma [2A85]	[12]
Ponatinib	DMYGJQO	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Ponatinib.	Mature B-cell lymphoma [2A85]	[12]
Cytarabine	DMZD5QR	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Cytarabine.	Mature B-cell lymphoma [2A85]	[12]
Mechlorethamine	DM0CVXA	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Mechlorethamine.	Mature T-cell lymphoma [2A90]	[12]
Dacarbazine	DMNPZL4	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Dacarbazine.	Melanoma [2C30]	[12]
Carfilzomib	DM48K0X	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Carfilzomib.	Multiple myeloma [2A83]	[12]
Panobinostat	DM58WKG	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Panobinostat.	Multiple myeloma [2A83]	[12]
Lenalidomide	DM6Q7U4	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Lenalidomide.	Multiple myeloma [2A83]	[12]
Thalidomide	DM70BU5	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Thalidomide.	Multiple myeloma [2A83]	[12]
Selinexor	DMBD4K3	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Selinexor.	Multiple myeloma [2A83]	[12]
Belantamab mafodotin	DMBT3AI	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Belantamab mafodotin.	Multiple myeloma [2A83]	[12]
Elotuzumab	DMEYHG9	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Elotuzumab.	Multiple myeloma [2A83]	[12]
Daratumumab	DMKCIUZ	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Daratumumab.	Multiple myeloma [2A83]	[12]
Melphalan	DMOLNHF	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Melphalan.	Multiple myeloma [2A83]	[12]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Tecfidera.	Multiple sclerosis [8A40]	[12]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Efalizumab and Siponimod.	Multiple sclerosis [8A40]	[16]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Efalizumab and Fingolimod.	Multiple sclerosis [8A40]	[17]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Efalizumab and Ozanimod.	Multiple sclerosis [8A40]	[13]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Deflazacort.	Muscular dystrophy [8C70]	[12]
Bexarotene	DMOBIKY	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Bexarotene.	Mycosis fungoides [2B01]	[12]
Romidepsin	DMT5GNL	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Romidepsin.	Mycosis fungoides [2B01]	[12]
Decitabine	DMQL8XJ	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Decitabine.	Myelodysplastic syndrome [2A37]	[12]
Azacitidine	DMTA5OE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Azacitidine.	Myelodysplastic syndrome [2A37]	[12]
Nilotinib	DM7HXWT	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Nilotinib.	Myeloproliferative neoplasm [2A20]	[12]
Ruxolitinib	DM7Q98D	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[12]
Imatinib	DM7RJXL	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Imatinib.	Myeloproliferative neoplasm [2A20]	[12]
Dasatinib	DMJV2EK	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Dasatinib.	Myeloproliferative neoplasm [2A20]	[12]
Hydroxyurea	DMOQVU9	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Hydroxyurea.	Myeloproliferative neoplasm [2A20]	[12]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[12]
Busulfan	DMXYJ9C	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Busulfan.	Myeloproliferative neoplasm [2A20]	[12]
Inebilizumab	DMI0RHA	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Inebilizumab.	Nervous system paraneoplastic/autoimmune disorder [8E4A]	[12]
Atezolizumab	DMMF8U0	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Atezolizumab.	Non-small cell lung cancer [2C25]	[12]
Olaparib	DM8QB1D	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Olaparib.	Ovarian cancer [2C73]	[12]
Rucaparib	DM9PVX8	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Rucaparib.	Ovarian cancer [2C73]	[12]
Carboplatin	DMG281S	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Carboplatin.	Ovarian cancer [2C73]	[12]
Altretamine	DMKLAYG	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Altretamine.	Ovarian cancer [2C73]	[12]
MK-4827	DMLYGH4	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and MK-4827.	Ovarian cancer [2C73]	[12]
Topotecan	DMP6G8T	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Topotecan.	Ovarian cancer [2C73]	[12]
Streptozocin	DMOF7AT	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Streptozocin.	Pancreatic cancer [2C10]	[12]
Pemetrexed	DMMX2E6	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Pemetrexed.	Pleural mesothelioma [2C26]	[12]
Prednisone	DM2HG4X	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Prednisone.	Postoperative inflammation [1A00-CA43]	[12]
Betamethasone	DMAHJEF	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Betamethasone.	Postoperative inflammation [1A00-CA43]	[12]
Hydrocortisone	DMGEMB7	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Hydrocortisone.	Postoperative inflammation [1A00-CA43]	[12]
Everolimus	DM8X2EH	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Everolimus.	Renal cell carcinoma [2C90]	[12]
Temsirolimus	DMS104F	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Temsirolimus.	Renal cell carcinoma [2C90]	[12]
Tocilizumab	DM7J6OR	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Tocilizumab.	Rheumatoid arthritis [FA20]	[12]
Canakinumab	DM8HLO5	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Canakinumab.	Rheumatoid arthritis [FA20]	[12]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Rilonacept.	Rheumatoid arthritis [FA20]	[12]
Golimumab	DMHZV7X	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Golimumab.	Rheumatoid arthritis [FA20]	[12]
Dexamethasone	DMMWZET	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Dexamethasone.	Rheumatoid arthritis [FA20]	[12]
Sarilumab	DMOGNXY	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Sarilumab.	Rheumatoid arthritis [FA20]	[12]
Leflunomide	DMR8ONJ	Major	Additive immunosuppressive effects by the combination of Efalizumab and Leflunomide.	Rheumatoid arthritis [FA20]	[14]
Abatacept	DMSA8RU	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Abatacept.	Rheumatoid arthritis [FA20]	[12]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Efalizumab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[18]
Mogamulizumab	DMISH0Z	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Mogamulizumab.	Sezary syndrome [2B02]	[12]
Floxuridine	DM04LR2	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Floxuridine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Dactinomycin	DM2YGNW	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Dactinomycin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Methylprednisolone	DM4BDON	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Methylprednisolone.	Solid tumour/cancer [2A00-2F9Z]	[12]
Cyclophosphamide	DM4O2Z7	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Cyclophosphamide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Vinblastine	DM5TVS3	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Vinblastine.	Solid tumour/cancer [2A00-2F9Z]	[12]
PDX-101	DM6OC53	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and PDX-101.	Solid tumour/cancer [2A00-2F9Z]	[12]
Ifosfamide	DMCT3I8	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Ifosfamide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Docetaxel	DMDI269	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Docetaxel.	Solid tumour/cancer [2A00-2F9Z]	[12]
Trabectedin	DMG3Y89	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Mitoxantrone	DMM39BF	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Mitoxantrone.	Solid tumour/cancer [2A00-2F9Z]	[12]
LEE011	DMMX75K	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and LEE011.	Solid tumour/cancer [2A00-2F9Z]	[12]
Etoposide	DMNH3PG	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Etoposide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Epirubicin	DMPDW6T	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Epirubicin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Prednisolone	DMQ8FR2	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Prednisolone.	Solid tumour/cancer [2A00-2F9Z]	[12]
Cisplatin	DMRHGI9	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Cisplatin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Gemcitabine	DMSE3I7	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Gemcitabine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Fluorouracil	DMUM7HZ	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Fluorouracil.	Solid tumour/cancer [2A00-2F9Z]	[12]
Taxol	DMUOT9V	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Taxol.	Solid tumour/cancer [2A00-2F9Z]	[12]
Doxorubicin	DMVP5YE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Doxorubicin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Vinorelbine	DMVXFYE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Vinorelbine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Trimetrexate	DMDEA85	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Trimetrexate.	Toxoplasmosis [1F57]	[12]
Sirolimus	DMGW1ID	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Sirolimus.	Transplant rejection [NE84]	[12]
Azathioprine	DMMZSXQ	Moderate	Additive myelosuppressive effects by the combination of Efalizumab and Azathioprine.	Transplant rejection [NE84]	[12]
Mycophenolate mofetil	DMPQAGE	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Mycophenolate mofetil.	Transplant rejection [NE84]	[12]
Belatacept	DMXLYQF	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Belatacept.	Transplant rejection [NE84]	[12]
Tacrolimus	DMZ7XNQ	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Tacrolimus.	Transplant rejection [NE84]	[12]
Durvalumab	DM4PVDY	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Durvalumab.	Ureteral cancer [2C92]	[12]
Triamcinolone	DM98IXF	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Triamcinolone.	Vasomotor/allergic rhinitis [CA08]	[12]
Trifluridine	DMG2YBD	Moderate	Additive immunosuppressive effects by the combination of Efalizumab and Trifluridine.	Virus infection [1A24-1D9Z]	[12]
-----------


⏷ Show the Full List of 147 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6593).
2	New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
3	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
4	[Successful therapy of discoid lupus erythematosus with efalizumab]. Hautarzt. 2010 Mar;61(3):246-9.
5	Corneal inflammation is inhibited by the LFA-1 antagonist, lifitegrast (SAR 1118). J Ocul Pharmacol Ther. 2013 May;29(4):395-402.
6	Small molecule antagonist of leukocyte function associated antigen-1 (LFA-1): structure-activity relationships leading to the identification of 6-(... J Med Chem. 2010 May 13;53(9):3814-30.
7	HECA-452+ T Cells Migrate Through Superficial Vascular Plexus but Not Through Deep Vascular Plexus Endothelium. Journal of Investigative Dermatology. 04/1997; 108(3):343-8.
8	Cytokine-induced phagocyte adhesion to human mesangial cells: role of CD11/CD18 integrins and ICAM-1. Am J Physiol. 1991 Dec;261(6 Pt 2):F1071-9.
9	Discovery of tetrahydroisoquinoline (THIQ) derivatives as potent and orally bioavailable LFA-1/ICAM-1 antagonists. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5269-73.
10	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2451).
11	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
12	Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
13	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
14	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
15	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
16	Cerner Multum, Inc. "Australian Product Information.".
17	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
18	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]