General Information of Drug Therapeutic Target (DTT) (ID: TT3WG5C)

DTT Name Monoamine oxidase type A (MAO-A)
Synonyms Monoamine oxidase A; Amine oxidase [flavin-containing] A
Gene Name MAOA
DTT Type
Successful target
[1]
Related Disease
Depression [ICD-11: 6A70-6A7Z]
Parkinsonism [ICD-11: 8A00]
BioChemical Class
CH-NH(2) donor oxidoreductase
UniProt ID
AOFA_HUMAN
TTD ID
T83875
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 1.4.3.4
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Function
MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues.
KEGG Pathway
Glycine, serine and threonine metabolism (hsa00260 )
Arginine and proline metabolism (hsa00330 )
Histidine metabolism (hsa00340 )
Tyrosine metabolism (hsa00350 )
Phenylalanine metabolism (hsa00360 )
Tryptophan metabolism (hsa00380 )
Drug metabolism - cytochrome P450 (hsa00982 )
Metabolic pathways (hsa01100 )
Serotonergic synapse (hsa04726 )
Dopaminergic synapse (hsa04728 )
Cocaine addiction (hsa05030 )
Amphetamine addiction (hsa05031 )
Alcoholism (hsa05034 )
Reactome Pathway
Norepinephrine Neurotransmitter Release Cycle (R-HSA-181430 )
BioCyc Pathway
MetaCyc:HS01798-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
4 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Clorgyline DMCEUJD Parkinson disease 8A00.0 Approved [2]
Isocarboxazid DMAF1NB Depression 6A70-6A7Z Approved [3]
Moclobemide DMNZWL7 Depression 6A70-6A7Z Approved [4]
Tranylcypromine DMGB5RE Major depressive disorder 6A70.3 Approved [1], [5]
------------------------------------------------------------------------------------
7 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Psoralen DMIZJ8M N. A. N. A. Phase 3 [6]
TRYPTAMINE DMAFPHB N. A. N. A. Phase 3 [7]
CHF-3381 DMQ2O8V Neuropathic pain 8E43.0 Phase 2 [8]
CX157 DMS2WB5 Mood disorder 6A60-6E23 Phase 2 [9]
Ladostigil DMJSY3Q Alzheimer disease 8A20 Phase 2 [10]
PIPERINE DMYEAB1 Vitiligo ED63.0 Phase 1/2 [11]
Desoxypeganine DMTR7EH Alcohol dependence 6C40.2 Phase 1 [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Clinical Trial Drug(s)
39 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AphanamgrandiolA DMLQ8N1 N. A. N. A. Patented [13]
Cyclic peptide derivative 1 DM78NOU N. A. N. A. Patented [14]
GypensapogeninA DMFHC0O N. A. N. A. Patented [13]
GypensapogeninB DMX4ET5 N. A. N. A. Patented [13]
Harmine DMPA5WD Discovery agent N.A. Patented [15], [11]
Heteroaryl-cyclopropylamine derivative 1 DMRF58Q N. A. N. A. Patented [14]
HouttuynoidA DMU5JC0 N. A. N. A. Patented [13]
IncarviatoneA DMBURAZ N. A. N. A. Patented [13]
KadcoccitoneA DM7UK5E N. A. N. A. Patented [13]
MyriberineA DMA8BLZ N. A. N. A. Patented [13]
N-(2-phenylcyclopropyl) amino acid derivative 3 DMFBRSL N. A. N. A. Patented [14]
PhyllanthoidA DM5H3R8 N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Aphanamixoid A DM23NEX N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Chukrasone A DMRHNOY N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Chukrasone B DM0K4XE N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Eryngiolide A DMDX1MK N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Neonectrolide A DMSYGHO N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Sarcaboside A DMRIEH3 N. A. N. A. Patented [13]
PMID25399762-Compound-Figure1-Sarcaboside B DMDL6TG N. A. N. A. Patented [13]
PMID25399762-Compound-Figure2-Artoxanthochromane DMG1EKV N. A. N. A. Patented [13]
PMID25399762-Compound-Figure2-Spirooliganone B DMYJ0I8 N. A. N. A. Patented [13]
PMID25399762-Compound-Figure3-Aspeverin DMP5Y19 N. A. N. A. Patented [13]
PMID25399762-Compound-Figure3-Fluevirosine A DM9KTRA N. A. N. A. Patented [13]
PMID25399762-Compound-Figure3-Lycojaponicumin A DMBSP1G N. A. N. A. Patented [13]
PMID25399762-Compound-Figure3-Lycojaponicumin B DMKP64Z N. A. N. A. Patented [13]
PMID25399762-Compound-Figure3-Lycojaponicumin C DM7NUT2 N. A. N. A. Patented [13]
PMID25399762-Compound-Table 5-8 DMLAS7K N. A. N. A. Patented [13]
PMID25399762-Compound-Table 5-O-methyl-M30 DM18FP4 N. A. N. A. Patented [13]
PMID29324067-Compound-25 DM0DAR1 N. A. N. A. Patented [16]
PMID29757691-Compound-4 DMFD9UZ N. A. N. A. Patented [17]
Schiff base compound 1 DMQD6IL Alzheimer disease 8A20 Patented [16]
Secondary and tertiary (hetero)arylamide derivative 2 DMIES9B N. A. N. A. Patented [16]
Tacrine-coumarin hybrid derivative 1 DM6YBTR N. A. N. A. Patented [16]
Tarnylcypromine derivative 2 DMEJR2F N. A. N. A. Patented [14]
Tarnylcypromine derivative 3 DMKJOMC N. A. N. A. Patented [14]
Tetra-hydro-isoquinoline derivative 1 DML86IO N. A. N. A. Patented [17]
Tetra-hydro-isoquinoline derivative 2 DM5CKVF N. A. N. A. Patented [17]
Tetra-hydro-isoquinoline derivative 3 DMCZA45 N. A. N. A. Patented [17]
Tetra-hydro-isoquinoline derivative 4 DMDV0MP N. A. N. A. Patented [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Patented Agent(s)
9 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Befloxatone DMZIV6D Major depressive disorder 6A70.3 Discontinued in Phase 3 [18]
Brofaromine DMTEQ0G Anxiety disorder 6B00-6B0Z Discontinued in Phase 2 [19]
CS-722 DMGYXA4 Epilepsy 8A60-8A68 Discontinued in Phase 2 [20]
Esuprone DM1DHOT Major depressive disorder 6A70.3 Discontinued in Phase 2 [21], [22]
RS-8359 DMERM0K Major depressive disorder 6A70.3 Discontinued in Phase 2 [23]
AS602868 DMKXDOI Multiple myeloma 2A83 Discontinued in Phase 1 [6]
BW-1370U87 DM296HE Major depressive disorder 6A70.3 Discontinued in Phase 1 [24], [22]
Bifemelane DMU73F0 Alzheimer disease 8A20 Terminated [25]
E-2011 DMD4GQ8 Anxiety disorder 6B00-6B0Z Terminated [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Discontinued Drug(s)
177 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine DMCB74T Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one DM1WCJV Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine DMG3MF2 Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one DM1YBJ2 Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine DMKPX7W Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one DM7BY4T Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine DMKFSQ8 Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one DMY1W20 Discovery agent N.A. Investigative [27]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine DMUPYN1 Discovery agent N.A. Investigative [27]
(+/-)-2-Phenylthiomorpholin-5-one DMSHDNO Discovery agent N.A. Investigative [27]
(+/-)-2-Phenylthiomorpholine DMNR3YL Discovery agent N.A. Investigative [27]
(6-Benzyloxy-2-naphthyl)-2-aminopropane DMF7LST Discovery agent N.A. Investigative [28]
(6-Butoxy-2-naphthyl)-2-aminopropane DM7BK9A Discovery agent N.A. Investigative [28]
(6-Ethoxy-2-naphthyl)-2-aminopropane DMM2EX6 Discovery agent N.A. Investigative [28]
(6-Methoxy-2-naphthyl)-2-aminopropane DM6YGQ3 Discovery agent N.A. Investigative [28]
(6-methylthio-2-naphthyl)isopropylamine DM39W5K Discovery agent N.A. Investigative [28]
(6-Propoxy-2-naphthyl)-2-aminopropane DMIFL3V Discovery agent N.A. Investigative [28]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile DMB9YAO Discovery agent N.A. Investigative [29]
(E)-5-(3-Chlorostyryl)isatin DMLIQUA Discovery agent N.A. Investigative [30]
(E)-5-(3-Fluorostyryl)isatin DMP4T9Z Discovery agent N.A. Investigative [30]
(E)-5-Styrylisatin DM1PCIX Discovery agent N.A. Investigative [30]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine DMKFPMC Discovery agent N.A. Investigative [31]
(R,S)-N-(R-phenylethyl)-1H-pyrrole-2-carboxamide DMPDO43 Discovery agent N.A. Investigative [32]
(R/R)BEFLOXATONE DM8I6MG Discovery agent N.A. Investigative [33]
(S)-2-amino-1-(4-butylthiophenyl)-propane DMPQ53V Discovery agent N.A. Investigative [34]
(S)-2-amino-1-(4-ethylthiophenyl)-propane DMFK7O1 Discovery agent N.A. Investigative [34]
(S)-2-amino-1-(4-methylthiophenyl)-propane DM06NUM Discovery agent N.A. Investigative [34]
(S)-2-amino-1-(4-propylthiophenyl)-propane DMAN7YJ Discovery agent N.A. Investigative [34]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole DM3JGVF Discovery agent N.A. Investigative [35]
1-(1-Naphthyl)-2-aminopropane DM6X9J3 Discovery agent N.A. Investigative [28]
1-(2-Naphthyl)-2-aminopropane DMBNZKH Discovery agent N.A. Investigative [28]
1-(3-(4-chlorobenzyl)quinoxalin-2-yl)hydrazine DMM36DE Discovery agent N.A. Investigative [36]
1-(3-benzyl-6,7-dichloroquinoxalin-2-yl)hydrazine DMTY41F Discovery agent N.A. Investigative [36]
1-(3-benzylquinoxalin-2-yl)hydrazine DMJCVQN Discovery agent N.A. Investigative [36]
1-(4-(benzyloxy)phenyl)propan-2-amine DMT81N3 Discovery agent N.A. Investigative [28]
1-(4-butoxyphenyl)propan-2-amine DM7GIZL Discovery agent N.A. Investigative [28]
1-(4-ethoxyphenyl)propan-2-amine DMZR94D Discovery agent N.A. Investigative [28]
1-(4-propoxyphenyl)propan-2-amine DMKNA5U Discovery agent N.A. Investigative [28]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole DMX8NYD Discovery agent N.A. Investigative [7]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole DM187UQ Discovery agent N.A. Investigative [37]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole DMH1VCE Discovery agent N.A. Investigative [37]
2-(3,4-dimethoxyphenyl)-4,5-dihydro-1H-imidazole DMLOX0Y Discovery agent N.A. Investigative [38]
2-(3-benzylquinoxalin-2-ylamino)ethanol DM6V91D Discovery agent N.A. Investigative [36]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline DM4X0SJ Discovery agent N.A. Investigative [38]
2-(4-methoxyphenyl)-4,5-dihydro-1H-imidazole DM0KUMX Discovery agent N.A. Investigative [38]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole DMDZ9RK Discovery agent N.A. Investigative [39]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole DMKY71Z Discovery agent N.A. Investigative [38]
2-Amino-1-(4-methylthiophenyl)propane DMJ2Z9G Discovery agent N.A. Investigative [28]
2-BFi DMFAW4R Discovery agent N.A. Investigative [40]
2-Bromo-N-(2-morpholinoethyl)nicotinamide DMYCENM Discovery agent N.A. Investigative [41]
2-Chloro-N-(2-morpholinoethyl)nicotinamide DMR8M36 Discovery agent N.A. Investigative [41]
2-Chloro-N-(3-morpholinopropyl)nicotinamide DM5S1DW Discovery agent N.A. Investigative [41]
2-Furan-2-yl-4,5-dihydro-1H-imidazole DMQIFJ9 Discovery agent N.A. Investigative [42]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide DMDKSZ0 Discovery agent N.A. Investigative [43]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide DMWXI6C Discovery agent N.A. Investigative [43]
2-oxo-N-phenyl-2H-chromene-3-carboxamide DMH8QWY Discovery agent N.A. Investigative [43]
2-Phenethyl-4,5-dihydro-1H-imidazole DM4H6PC Discovery agent N.A. Investigative [42]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole DM5E74G Discovery agent N.A. Investigative [42]
2-phenyl-5H-indeno[1,2-d]pyrimidine DMMDS2T Discovery agent N.A. Investigative [44]
2-phenyl-9H-indeno[2,1-d]pyrimidine DMMHSYV Discovery agent N.A. Investigative [44]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide DMZFKDW Discovery agent N.A. Investigative [29]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin DMN4Z27 Discovery agent N.A. Investigative [45]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin DM1MC06 Discovery agent N.A. Investigative [45]
3,4-Benzo-7-acetonyloxy-8-methylcoumarin DMKC6L8 Discovery agent N.A. Investigative [45]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide DMMZURL Discovery agent N.A. Investigative [46]
3-aminoacetamido-4'-methylfuro[3,2-g]coumarin DM0GJZM Discovery agent N.A. Investigative [47]
3-benzyl-N-(2-morpholinoethyl)quinoxalin-2-amine DMZIOJS Discovery agent N.A. Investigative [36]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide DMIEZGD Discovery agent N.A. Investigative [46]
3-methyl-2(1H)-thioxo-4(3H)-quinazolinone DMHVNQM Discovery agent N.A. Investigative [48]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin DMQNXL1 Discovery agent N.A. Investigative [45]
4,9-Dihydro-3H-beta-carboline DM27HMT Discovery agent N.A. Investigative [35]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid DMWIALU Discovery agent N.A. Investigative [43]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one DMTB80W Discovery agent N.A. Investigative [29]
4-Chloro-N-(2-morpholinoethyl)nicotinamide DMVCLP8 Discovery agent N.A. Investigative [41]
4-Chloro-N-(3-morpholinopropyl)nicotinamide DMM8G6H Discovery agent N.A. Investigative [41]
4-methyl-2H-benzofuro[3,2-g]chromen-2-one DMKRHQ3 Discovery agent N.A. Investigative [47]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one DM9K7CQ Discovery agent N.A. Investigative [45]
5,6-Dichloro-N-(2-morpholinoethyl)nicotinamide DMR2OMU Discovery agent N.A. Investigative [41]
5,6-Dichloro-N-(3-morpholinopropyl)nicotinamide DMZL87A Discovery agent N.A. Investigative [41]
5-Azidomethyl-3-pyrrol-1-yl-oxazolidin-2-one DM0HO6C Discovery agent N.A. Investigative [33]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline DMMI4H3 Discovery agent N.A. Investigative [7]
5-Bromo-4,9-dihydro-3H-beta-carboline DM2SEFR Discovery agent N.A. Investigative [7]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one DMT9FQN Discovery agent N.A. Investigative [33]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline DMNRSYA Discovery agent N.A. Investigative [7]
5-Methoxy-4,9-dihydro-3H-beta-carboline DMBOMZE Discovery agent N.A. Investigative [7]
5-Methoxymethyl-3-pyrrol-1-yl-oxazolidin-2-one DMJ1HX2 Discovery agent N.A. Investigative [33]
6,11-dihydro-5H-benzo[a]carbazole DMSB8WQ Discovery agent N.A. Investigative [44]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one DMU1CV4 Discovery agent N.A. Investigative [45]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline DMXQ8K1 Discovery agent N.A. Investigative [7]
6-Bromo-4,9-dihydro-3H-beta-carboline DM64KOZ Discovery agent N.A. Investigative [7]
6-Chloro-N-(2-morpholinoethyl)nicotinamide DM10A9S Discovery agent N.A. Investigative [41]
6-Chloro-N-(3-morpholinopropyl)nicotinamide DM78I4P Discovery agent N.A. Investigative [41]
6-Fluoro-N-(2-morpholinoethyl)nicotinamide DMA1QH0 Discovery agent N.A. Investigative [41]
6-Hydroxy-N-(2-morpholinoethyl)nicotinamide DM6KVO0 Discovery agent N.A. Investigative [41]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline DMSA367 Discovery agent N.A. Investigative [35]
6-Methoxy-4,9-dihydro-3H-beta-carboline DM98FQO Discovery agent N.A. Investigative [35]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin DM762G3 Discovery agent N.A. Investigative [49]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin DMQCDT1 Discovery agent N.A. Investigative [45]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin DMQMTSX Discovery agent N.A. Investigative [45]
7-acetonyloxy-3-acetylamino-8-methoxycoumarin DMYSNQO Discovery agent N.A. Investigative [47]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline DMVTH0Q Discovery agent N.A. Investigative [7]
7-Bromo-4,9-dihydro-3H-beta-carboline DMCWYT7 Discovery agent N.A. Investigative [7]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline DMQ1BE8 Discovery agent N.A. Investigative [42]
7-Methoxy-9H-beta-carboline DMHKMU1 Discovery agent N.A. Investigative [7]
8-(3-Bromobenzyloxy)caffeine DM2RA4N Discovery agent N.A. Investigative [50]
8-(3-Chlorobenzyloxy)caffeine DM7HMNP Discovery agent N.A. Investigative [50]
8-(3-Fluorobenzyloxy)caffeine DME85GS Discovery agent N.A. Investigative [50]
8-(3-Methoxybenzyloxy)caffeine DMLY46X Discovery agent N.A. Investigative [50]
8-(3-Methylbenzyloxy)caffeine DMB9645 Discovery agent N.A. Investigative [50]
8-Benzyloxycaffeine DMJQ8AP Discovery agent N.A. Investigative [50]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline DMALRU4 Discovery agent N.A. Investigative [7]
8-Bromo-4,9-dihydro-3H-beta-carboline DM4V5RU Discovery agent N.A. Investigative [7]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline DMHE7J5 Discovery agent N.A. Investigative [7]
8-Methoxy-4,9-dihydro-3H-beta-carboline DM8MBSN Discovery agent N.A. Investigative [7]
8-[(3-Trifluoromethyl)benzyloxy]caffeine DMT3IOB Discovery agent N.A. Investigative [50]
9-(3-aminopropoxy)-7H-furo[3,2-g]chromen-7-one DM51MRV Discovery agent N.A. Investigative [47]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline DMF7QS5 Discovery agent N.A. Investigative [7]
Beta-methoxyamphetamine DMA9CSG Discovery agent N.A. Investigative [51], [28]
C-(1H-Indol-3-yl)-methylamine DMDLK9G Discovery agent N.A. Investigative [7]
CGS-19281A DMDB2KJ Discovery agent N.A. Investigative [35]
Cis-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine DMWX6J0 Discovery agent N.A. Investigative [52]
Cis-2-phenylcyclopropylamine DMKZ32J Discovery agent N.A. Investigative [52]
DECYL(DIMETHYL)PHOSPHINE OXIDE DMQMR3P Discovery agent N.A. Investigative [15]
Ethyl 4-(2-oxo-2H-chromene-3-carboxamido)benzoate DMQ3LMF Discovery agent N.A. Investigative [43]
FA-70 DMDBO89 Major depressive disorder 6A70.3 Investigative [53]
Flavin-Adenine Dinucleotide DM5S4GK Discovery agent N.A. Investigative [54]
HYDRAZINECARBOXAMIDE DMARWG5 Discovery agent N.A. Investigative [55]
IPRONIAZIDE DM42ENF Discovery agent N.A. Investigative [41]
MMDA DMUWVGP Discovery agent N.A. Investigative [54]
N'-(2-phenylallyl)hydrazine hydrochloride DMBR1MX Discovery agent N.A. Investigative [56]
N-((1H-indol-2-yl)methyl)(phenyl)methanamine DM093GO Discovery agent N.A. Investigative [57]
N-((1H-indol-2-yl)methyl)-2-phenylethanamine DMYUAXR Discovery agent N.A. Investigative [57]
N-(1-Methyl-1H-indol-2-ylmethyl)-N-phenylamine DMY3UZH Discovery agent N.A. Investigative [57]
N-(1H-Indol-2-ylmethyl)-N-(4-phenylbutyl)amine DMHAGSW Discovery agent N.A. Investigative [57]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine DMCM51R Discovery agent N.A. Investigative [57]
N-(1H-Indol-2-ylmethyl)-N-phenylamine DMXD592 Discovery agent N.A. Investigative [57]
N-(2-benzyl),N-(1-methylpyrrol-2-ylmethyl)amine DM72BSO Discovery agent N.A. Investigative [32]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide DM3SF5M Discovery agent N.A. Investigative [46]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine DM1ADE5 Discovery agent N.A. Investigative [32]
N-(2-Phenylethyl)-1H-indole-2-carboxamide DMJCO7F Discovery agent N.A. Investigative [57]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide DMKAX3Q Discovery agent N.A. Investigative [57]
N-(3-phenylpropyl)-1H-pyrrole-2-carboxamide DMZ3I6U Discovery agent N.A. Investigative [32]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide DMWTVJH Discovery agent N.A. Investigative [43]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide DMTCMUG Discovery agent N.A. Investigative [57]
N-(4-phenylbutyl)-1H-pyrrole-2-carboxamide DMSREW5 Discovery agent N.A. Investigative [32]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine DM87YJW Discovery agent N.A. Investigative [32]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine DMTJ5WL Discovery agent N.A. Investigative [32]
N-2-phenylethyl-1H-pyrrole-2-carboxamide DM3WTDL Discovery agent N.A. Investigative [32]
N-Benzyl,N-methyl-1H-indole-2-carboxamide DMHVRFM Discovery agent N.A. Investigative [57]
N-benzyl,N-methyl-1H-pyrrole-2-carboxamide DM8I7N2 Discovery agent N.A. Investigative [32]
N-Benzyl-(6-butoxy-2-naphthyl)-2-aminopropane DMN9WZ3 Discovery agent N.A. Investigative [28]
N-Benzyl-(6-methoxy-2-naphthyl)-2-aminopropane DMKJ6F8 Discovery agent N.A. Investigative [28]
N-Benzyl-1H-indole-2-carboxamide DMA3YWU Discovery agent N.A. Investigative [57]
N-benzyl-1H-pyrrole-2-carboxamide DM73ZHV Discovery agent N.A. Investigative [32]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine DM0NJAL Discovery agent N.A. Investigative [57]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine DM83AEM Discovery agent N.A. Investigative [32]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine DMZ24XT Discovery agent N.A. Investigative [32]
N-Methyl,N-phenyl-1H-indole-2-carboxamide DMM3B21 Discovery agent N.A. Investigative [57]
N-methyl-N-(prop-2-ynyl)-1H-pyrrole-2-carboxamide DM796AX Discovery agent N.A. Investigative [32]
N-Phenyl-1-methyl-1H-indole-2-carboxamide DM1XV0O Discovery agent N.A. Investigative [57]
N-Phenyl-1H-indole-2-carboxamide DM7V025 Discovery agent N.A. Investigative [57]
N-phenyl-1H-pyrrole-2-carboxamide DMBGIUE Discovery agent N.A. Investigative [32]
N-propargyl-1H-pyrrole-2-carboxamide DMNYQ28 Discovery agent N.A. Investigative [32]
N2-[4-(benzyloxy)benzyl]glycinamide DMOZ1IY Discovery agent N.A. Investigative [58]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide DMEWP9L Discovery agent N.A. Investigative [58]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide DMLPJGX Discovery agent N.A. Investigative [58]
NSC-656158 DM52NOI Discovery agent N.A. Investigative [59]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate DMHDWTS Discovery agent N.A. Investigative [38]
PNU-22394 DMHTPSF Discovery agent N.A. Investigative [7]
TOLOXATONE DMHV5NK Discovery agent N.A. Investigative [60]
TRACIZOLINE DM18CV3 Discovery agent N.A. Investigative [42]
Trans-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine DM27TPM Discovery agent N.A. Investigative [52]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine DMH1S57 Discovery agent N.A. Investigative [52]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine DMO01T8 Discovery agent N.A. Investigative [52]
Trans-2-fluoro-2-p-tolylcyclopropanamine DM392QT Discovery agent N.A. Investigative [52]
Trans-2-fluoro-2-phenylcyclopropylamin DMVGAFR Discovery agent N.A. Investigative [52]
TRYPTOLINE DMV19K7 Discovery agent N.A. Investigative [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 177 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Alzheimer's disease 8A00.0 Entorhinal cortex 8.14E-01 0.05 0.1
Vitiligo EA90 Skin 1.20E-01 -0.43 -1.13
Parkinson's disease 8A00.0 Substantia nigra tissue 6.93E-01 -0.36 -0.41
Major depressive disorder 6A20 Pre-frontal cortex 4.12E-01 -0.02 -0.08
------------------------------------------------------------------------------------

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name Monoamine oxidase type A (MAO-A) DME Info
Gene Name MAOA
5 Approved Drug(s) Metabolized by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Almotriptan malate DMFG5ST Migraine 8A80 Approved [61]
Epinephrine DM3KJBC Allergy 4A80-4A85 Approved [62]
Naratriptan DMO50U2 Migraine 8A80 Approved [63]
Safinamide mesylate DM0J2ZT Parkinson disease 8A00.0 Approved [64]
Zolmitriptan DM1IB4Q Migraine 8A80 Approved [65]
------------------------------------------------------------------------------------
3 Investigative Drug(s) Metabolized by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Benzylamine DMRM6ES Chronic functional vomiting DD90.4 Investigative [66]
Phenethylamine DMX0G4F Discovery agent N.A. Investigative [66]
Serotonin DMOFCRY Discovery agent N.A. Investigative [66]
------------------------------------------------------------------------------------

References

1 Tramadol and another atypical opioid meperidine have exaggerated serotonin syndrome behavioural effects, but decreased analgesic effects, in genetically deficient serotonin transporter (SERT) mice. Int J Neuropsychopharmacol. 2009 Mar 11:1-11.
2 Further investigation into the mechanism of tachykinin NK(2) receptor-triggered serotonin release from guinea-pig proximal colon. J Pharmacol Sci. 2009 May;110(1):122-6.
3 MAOIs in the contemporary treatment of depression. Neuropsychopharmacology. 1995 May;12(3):185-219.
4 Efficacy of citalopram and moclobemide in patients with social phobia: some preliminary findings. Hum Psychopharmacol. 2002 Dec;17(8):401-5.
5 Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73.
6 Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
7 Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.
8 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
9 Reversible inhibitors of monoamine oxidase-A (RIMAs): robust, reversible inhibition of human brain MAO-A by CX157. Neuropsychopharmacology. 2010 Feb;35(3):623-31.
10 Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
11 Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40.
12 Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
13 Novel monoamine oxidase inhibitors: a patent review (2012 - 2014).Expert Opin Ther Pat. 2015 Jan;25(1):91-110.
14 LSD1 inhibitors: a patent review (2010-2015).Expert Opin Ther Pat. 2016 May;26(5):565-80.
15 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
16 MAO inhibitors and their wider applications: a patent review.Expert Opin Ther Pat. 2018 Mar;28(3):211-226.
17 A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465.
18 Befloxatone, a new reversible and selective monoamine oxidase-A inhibitor. II. Pharmacological profile. J Pharmacol Exp Ther. 1996 Apr;277(1):265-77.
19 Preclinical profiles of the novel reversible MAO-A inhibitors, moclobemide and brofaromine, in comparison with irreversible MAO inhibitors. J Neural Transm Suppl. 1989;28:5-20.
20 Mechanisms of spinal reflex depressant effects of CS-722, a newly synthesized centrally acting muscle relaxant, in spinal rats. Neuropharmacology. 1992 Sep;31(9):949-54.
21 MAO-A inhibition in brain after dosing with esuprone, moclobemide and placebo in healthy volunteers: in vivo studies with positron emission tomography. Eur J Clin Pharmacol. 1997;52(2):121-8.
22 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
23 Stereospecific oxidation of the (S)-enantiomer of RS-8359, a selective and reversible monoamine oxidase A (MAO-A) inhibitor, by aldehyde oxidase. Xenobiotica. 2005 Jun;35(6):561-73.
24 Preclinical and early clinical studies with BW 1370U87, a reversible competitive monoamine oxidase-A inhibitor. Clin Neuropharmacol. 1993;16 Suppl 2:S25-33.
25 4-(O-benzylphenoxy)-N-methylbutylamine (bifemelane) and other 4-(O-benzylphenoxy)-N-methylalkylamines as new inhibitors of type A and B monoamine oxidase. J Neurochem. 1988 Jan;50(1):243-7.
26 Species differences and mechanism of the epimerization of a new MAO-A inhibitor. Xenobiotica. 1998 Mar;28(3):269-80.
27 2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1388-95.
28 Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. Bioorg Med Chem. 2009 Mar 15;17(6):2452-60.
29 Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)ox... J Med Chem. 2009 Nov 12;52(21):6685-706.
30 Inhibition of monoamine oxidase by (E)-styrylisatin analogues. Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13.
31 Novel dual inhibitors of AChE and MAO derived from hydroxy aminoindan and phenethylamine as potential treatment for Alzheimer's disease. J Med Chem. 2002 Nov 21;45(24):5260-79.
32 New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. J Med Chem. 2007 Mar 8;50(5):922-31.
33 3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. J Med Chem. 2002 Mar 14;45(6):1180-3.
34 Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. Bioorg Med Chem. 2007 Aug 1;15(15):5198-206.
35 Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.
36 Synthesis of 3-benzyl-2-substituted quinoxalines as novel monoamine oxidase A inhibitors. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1753-6.
37 Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70.
38 Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9.
39 3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. J Med Chem. 2006 Sep 7;49(18):5578-86.
40 Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.
41 Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1659-64.
42 Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.
43 Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. J Med Chem. 2009 Apr 9;52(7):1935-42.
44 Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. J Med Chem. 2007 Nov 1;50(22):5364-71.
45 Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. J Med Chem. 2008 Nov 13;51(21):6740-51.
46 Inhibition of monoamine oxidase by indole and benzofuran derivatives. Eur J Med Chem. 2010 Oct;45(10):4458-66.
47 A QSAR model for in silico screening of MAO-A inhibitors. Prediction, synthesis, and biological assay of novel coumarins. J Med Chem. 2006 Feb 9;49(3):1149-56.
48 New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A ... Bioorg Med Chem. 2009 Jan 15;17(2):675-89.
49 Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. J Med Chem. 2007 Nov 15;50(23):5848-52.
50 Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. Bioorg Med Chem. 2010 Feb;18(3):1018-28.
51 Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
52 Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases... Bioorg Med Chem. 2008 Aug 1;16(15):7148-66.
53 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2489).
54 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
55 Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxi... J Med Chem. 2004 Nov 18;47(24):5860-71.
56 Design, synthesis, and biological evaluation of semicarbazide-sensitive amine oxidase (SSAO) inhibitors with anti-inflammatory activity. J Med Chem. 2006 Apr 6;49(7):2166-73.
57 Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. Bioorg Med Chem. 2008 Nov 15;16(22):9729-40.
58 Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoa... J Med Chem. 2007 Oct 4;50(20):4909-16.
59 Synthesis and preclinical evaluations of 2-(2-fluorophenyl)-6,7-methylenedioxyquinolin-4-one monosodium phosphate (CHM-1-P-Na) as a potent antitumo... J Med Chem. 2010 Feb 25;53(4):1616-26.
60 Quercetin as the active principle of Hypericum hircinum exerts a selective inhibitory activity against MAO-A: extraction, biological analysis, and ... J Nat Prod. 2006 Jun;69(6):945-9.
61 Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
62 Role of monoamine-oxidase-A-gene variation in the development of glioblastoma in males: a case control study. J Neurooncol. 2019 Nov;145(2):287-294.
63 Migraine pharmacotherapy with oral triptans: a rational approach to clinical management. Expert Opin Pharmacother. 2000 Mar;1(3):391-404.
64 Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase. J Med Chem. 2007 Oct 4;50(20):4909-16.
65 Med-psych drug-drug interactions update. Psychosomatics. 2002 May;43(3):245-7.
66 Do monomeric vs dimeric forms of MAO-A make a difference? A direct comparison of the catalytic properties of rat and human MAO-A's. J Neural Transm (Vienna). 2007;114(6):721-4.