Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT3WG5C)

• DTT Name: Monoamine oxidase type A (MAO-A)
• Synonyms: Monoamine oxidase A; Amine oxidase [flavin-containing] A
• Gene Name: MAOA
• DTT Type: Successful target; [1]
• BioChemical Class: CH-NH(2) donor oxidoreductase
• UniProt ID: AOFA_HUMAN
• TTD ID: T83875
• EC Number: EC 1.4.3.4
• Sequence:
  MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
  DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
  YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
  NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
  NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
  GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
  LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
  RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
  VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
• Function: MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues.
• KEGG Pathway:
  Glycine, serine and threonine metabolism (hsa00260)
  Arginine and proline metabolism (hsa00330)
  Histidine metabolism (hsa00340)
  Tyrosine metabolism (hsa00350)
  Phenylalanine metabolism (hsa00360)
  Tryptophan metabolism (hsa00380)
  Drug metabolism - cytochrome P450 (hsa00982)
  Metabolic pathways (hsa01100)
  Serotonergic synapse (hsa04726)
  Dopaminergic synapse (hsa04728)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
• Reactome Pathway: Norepinephrine Neurotransmitter Release Cycle (R-HSA-181430)
• BioCyc Pathway: MetaCyc:HS01798-MON

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Clorgyline	DMCEUJD	Parkinson disease	8A00.0	Approved	[2]
Isocarboxazid	DMAF1NB	Depression	6A70-6A7Z	Approved	[3]
Moclobemide	DMNZWL7	Depression	6A70-6A7Z	Approved	[4]
Tranylcypromine	DMGB5RE	Major depressive disorder	6A70.3	Approved	[1]

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Psoralen	DMIZJ8M	N. A.	N. A.	Phase 3	[5]
TRYPTAMINE	DMAFPHB	N. A.	N. A.	Phase 3	[6]
CHF-3381	DMQ2O8V	Neuropathic pain	8E43.0	Phase 2	[7]
CX157	DMS2WB5	Mood disorder	6A60-6E23	Phase 2	[8]
Ladostigil	DMJSY3Q	Alzheimer disease	8A20	Phase 2	[9]
PIPERINE	DMYEAB1	Vitiligo	ED63.0	Phase 1/2	[10]
Desoxypeganine	DMTR7EH	Alcohol dependence	6C40.2	Phase 1	[11]

39 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AphanamgrandiolA	DMLQ8N1	N. A.	N. A.	Patented	[12]
Cyclic peptide derivative 1	DM78NOU	N. A.	N. A.	Patented	[13]
GypensapogeninA	DMFHC0O	N. A.	N. A.	Patented	[12]
GypensapogeninB	DMX4ET5	N. A.	N. A.	Patented	[12]
Harmine	DMPA5WD	Discovery agent	N.A.	Patented	[14]
Heteroaryl-cyclopropylamine derivative 1	DMRF58Q	N. A.	N. A.	Patented	[13]
HouttuynoidA	DMU5JC0	N. A.	N. A.	Patented	[12]
IncarviatoneA	DMBURAZ	N. A.	N. A.	Patented	[12]
KadcoccitoneA	DM7UK5E	N. A.	N. A.	Patented	[12]
MyriberineA	DMA8BLZ	N. A.	N. A.	Patented	[12]
N-(2-phenylcyclopropyl) amino acid derivative 3	DMFBRSL	N. A.	N. A.	Patented	[13]
PhyllanthoidA	DM5H3R8	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Aphanamixoid A	DM23NEX	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Chukrasone A	DMRHNOY	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Chukrasone B	DM0K4XE	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Eryngiolide A	DMDX1MK	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Neonectrolide A	DMSYGHO	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Sarcaboside A	DMRIEH3	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure1-Sarcaboside B	DMDL6TG	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure2-Artoxanthochromane	DMG1EKV	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure2-Spirooliganone B	DMYJ0I8	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure3-Aspeverin	DMP5Y19	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure3-Fluevirosine A	DM9KTRA	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure3-Lycojaponicumin A	DMBSP1G	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure3-Lycojaponicumin B	DMKP64Z	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Figure3-Lycojaponicumin C	DM7NUT2	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Table 5-8	DMLAS7K	N. A.	N. A.	Patented	[12]
PMID25399762-Compound-Table 5-O-methyl-M30	DM18FP4	N. A.	N. A.	Patented	[12]
PMID29324067-Compound-25	DM0DAR1	N. A.	N. A.	Patented	[15]
PMID29757691-Compound-4	DMFD9UZ	N. A.	N. A.	Patented	[16]
Schiff base compound 1	DMQD6IL	Alzheimer disease	8A20	Patented	[15]
Secondary and tertiary (hetero)arylamide derivative 2	DMIES9B	N. A.	N. A.	Patented	[15]
Tacrine-coumarin hybrid derivative 1	DM6YBTR	N. A.	N. A.	Patented	[15]
Tarnylcypromine derivative 2	DMEJR2F	N. A.	N. A.	Patented	[13]
Tarnylcypromine derivative 3	DMKJOMC	N. A.	N. A.	Patented	[13]
Tetra-hydro-isoquinoline derivative 1	DML86IO	N. A.	N. A.	Patented	[16]
Tetra-hydro-isoquinoline derivative 2	DM5CKVF	N. A.	N. A.	Patented	[16]
Tetra-hydro-isoquinoline derivative 3	DMCZA45	N. A.	N. A.	Patented	[16]
Tetra-hydro-isoquinoline derivative 4	DMDV0MP	N. A.	N. A.	Patented	[16]

9 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Befloxatone	DMZIV6D	Major depressive disorder	6A70.3	Discontinued in Phase 3	[17]
Brofaromine	DMTEQ0G	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[18]
CS-722	DMGYXA4	Epilepsy	8A60-8A68	Discontinued in Phase 2	[19]
Esuprone	DM1DHOT	Major depressive disorder	6A70.3	Discontinued in Phase 2	[20]
RS-8359	DMERM0K	Major depressive disorder	6A70.3	Discontinued in Phase 2	[21]
AS602868	DMKXDOI	Multiple myeloma	2A83	Discontinued in Phase 1	[5]
BW-1370U87	DM296HE	Major depressive disorder	6A70.3	Discontinued in Phase 1	[22]
Bifemelane	DMU73F0	Alzheimer disease	8A20	Terminated	[23]
E-2011	DMD4GQ8	Anxiety disorder	6B00-6B0Z	Terminated	[24]

177 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine	DMCB74T	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one	DM1WCJV	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine	DMG3MF2	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one	DM1YBJ2	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine	DMKPX7W	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one	DM7BY4T	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine	DMKFSQ8	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one	DMY1W20	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine	DMUPYN1	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-Phenylthiomorpholin-5-one	DMSHDNO	Discovery agent	N.A.	Investigative	[25]
(+/-)-2-Phenylthiomorpholine	DMNR3YL	Discovery agent	N.A.	Investigative	[25]
(6-Benzyloxy-2-naphthyl)-2-aminopropane	DMF7LST	Discovery agent	N.A.	Investigative	[26]
(6-Butoxy-2-naphthyl)-2-aminopropane	DM7BK9A	Discovery agent	N.A.	Investigative	[26]
(6-Ethoxy-2-naphthyl)-2-aminopropane	DMM2EX6	Discovery agent	N.A.	Investigative	[26]
(6-Methoxy-2-naphthyl)-2-aminopropane	DM6YGQ3	Discovery agent	N.A.	Investigative	[26]
(6-methylthio-2-naphthyl)isopropylamine	DM39W5K	Discovery agent	N.A.	Investigative	[26]
(6-Propoxy-2-naphthyl)-2-aminopropane	DMIFL3V	Discovery agent	N.A.	Investigative	[26]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile	DMB9YAO	Discovery agent	N.A.	Investigative	[27]
(E)-5-(3-Chlorostyryl)isatin	DMLIQUA	Discovery agent	N.A.	Investigative	[28]
(E)-5-(3-Fluorostyryl)isatin	DMP4T9Z	Discovery agent	N.A.	Investigative	[28]
(E)-5-Styrylisatin	DM1PCIX	Discovery agent	N.A.	Investigative	[28]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine	DMKFPMC	Discovery agent	N.A.	Investigative	[29]
(R,S)-N-(R-phenylethyl)-1H-pyrrole-2-carboxamide	DMPDO43	Discovery agent	N.A.	Investigative	[30]
(R/R)BEFLOXATONE	DM8I6MG	Discovery agent	N.A.	Investigative	[31]
(S)-2-amino-1-(4-butylthiophenyl)-propane	DMPQ53V	Discovery agent	N.A.	Investigative	[32]
(S)-2-amino-1-(4-ethylthiophenyl)-propane	DMFK7O1	Discovery agent	N.A.	Investigative	[32]
(S)-2-amino-1-(4-methylthiophenyl)-propane	DM06NUM	Discovery agent	N.A.	Investigative	[32]
(S)-2-amino-1-(4-propylthiophenyl)-propane	DMAN7YJ	Discovery agent	N.A.	Investigative	[32]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole	DM3JGVF	Discovery agent	N.A.	Investigative	[33]
1-(1-Naphthyl)-2-aminopropane	DM6X9J3	Discovery agent	N.A.	Investigative	[26]
1-(2-Naphthyl)-2-aminopropane	DMBNZKH	Discovery agent	N.A.	Investigative	[26]
1-(3-(4-chlorobenzyl)quinoxalin-2-yl)hydrazine	DMM36DE	Discovery agent	N.A.	Investigative	[34]
1-(3-benzyl-6,7-dichloroquinoxalin-2-yl)hydrazine	DMTY41F	Discovery agent	N.A.	Investigative	[34]
1-(3-benzylquinoxalin-2-yl)hydrazine	DMJCVQN	Discovery agent	N.A.	Investigative	[34]
1-(4-(benzyloxy)phenyl)propan-2-amine	DMT81N3	Discovery agent	N.A.	Investigative	[26]
1-(4-butoxyphenyl)propan-2-amine	DM7GIZL	Discovery agent	N.A.	Investigative	[26]
1-(4-ethoxyphenyl)propan-2-amine	DMZR94D	Discovery agent	N.A.	Investigative	[26]
1-(4-propoxyphenyl)propan-2-amine	DMKNA5U	Discovery agent	N.A.	Investigative	[26]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole	DMX8NYD	Discovery agent	N.A.	Investigative	[6]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole	DM187UQ	Discovery agent	N.A.	Investigative	[35]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole	DMH1VCE	Discovery agent	N.A.	Investigative	[35]
2-(3,4-dimethoxyphenyl)-4,5-dihydro-1H-imidazole	DMLOX0Y	Discovery agent	N.A.	Investigative	[36]
2-(3-benzylquinoxalin-2-ylamino)ethanol	DM6V91D	Discovery agent	N.A.	Investigative	[34]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline	DM4X0SJ	Discovery agent	N.A.	Investigative	[36]
2-(4-methoxyphenyl)-4,5-dihydro-1H-imidazole	DM0KUMX	Discovery agent	N.A.	Investigative	[36]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole	DMDZ9RK	Discovery agent	N.A.	Investigative	[37]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole	DMKY71Z	Discovery agent	N.A.	Investigative	[36]
2-Amino-1-(4-methylthiophenyl)propane	DMJ2Z9G	Discovery agent	N.A.	Investigative	[26]
2-BFi	DMFAW4R	Discovery agent	N.A.	Investigative	[38]
2-Bromo-N-(2-morpholinoethyl)nicotinamide	DMYCENM	Discovery agent	N.A.	Investigative	[39]
2-Chloro-N-(2-morpholinoethyl)nicotinamide	DMR8M36	Discovery agent	N.A.	Investigative	[39]
2-Chloro-N-(3-morpholinopropyl)nicotinamide	DM5S1DW	Discovery agent	N.A.	Investigative	[39]
2-Furan-2-yl-4,5-dihydro-1H-imidazole	DMQIFJ9	Discovery agent	N.A.	Investigative	[40]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide	DMDKSZ0	Discovery agent	N.A.	Investigative	[41]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide	DMWXI6C	Discovery agent	N.A.	Investigative	[41]
2-oxo-N-phenyl-2H-chromene-3-carboxamide	DMH8QWY	Discovery agent	N.A.	Investigative	[41]
2-Phenethyl-4,5-dihydro-1H-imidazole	DM4H6PC	Discovery agent	N.A.	Investigative	[40]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole	DM5E74G	Discovery agent	N.A.	Investigative	[40]
2-phenyl-5H-indeno[1,2-d]pyrimidine	DMMDS2T	Discovery agent	N.A.	Investigative	[42]
2-phenyl-9H-indeno[2,1-d]pyrimidine	DMMHSYV	Discovery agent	N.A.	Investigative	[42]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide	DMZFKDW	Discovery agent	N.A.	Investigative	[27]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin	DMN4Z27	Discovery agent	N.A.	Investigative	[43]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin	DM1MC06	Discovery agent	N.A.	Investigative	[43]
3,4-Benzo-7-acetonyloxy-8-methylcoumarin	DMKC6L8	Discovery agent	N.A.	Investigative	[43]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide	DMMZURL	Discovery agent	N.A.	Investigative	[44]
3-aminoacetamido-4'-methylfuro[3,2-g]coumarin	DM0GJZM	Discovery agent	N.A.	Investigative	[45]
3-benzyl-N-(2-morpholinoethyl)quinoxalin-2-amine	DMZIOJS	Discovery agent	N.A.	Investigative	[34]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide	DMIEZGD	Discovery agent	N.A.	Investigative	[44]
3-methyl-2(1H)-thioxo-4(3H)-quinazolinone	DMHVNQM	Discovery agent	N.A.	Investigative	[46]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin	DMQNXL1	Discovery agent	N.A.	Investigative	[43]
4,9-Dihydro-3H-beta-carboline	DM27HMT	Discovery agent	N.A.	Investigative	[33]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid	DMWIALU	Discovery agent	N.A.	Investigative	[41]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one	DMTB80W	Discovery agent	N.A.	Investigative	[27]
4-Chloro-N-(2-morpholinoethyl)nicotinamide	DMVCLP8	Discovery agent	N.A.	Investigative	[39]
4-Chloro-N-(3-morpholinopropyl)nicotinamide	DMM8G6H	Discovery agent	N.A.	Investigative	[39]
4-methyl-2H-benzofuro[3,2-g]chromen-2-one	DMKRHQ3	Discovery agent	N.A.	Investigative	[45]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one	DM9K7CQ	Discovery agent	N.A.	Investigative	[43]
5,6-Dichloro-N-(2-morpholinoethyl)nicotinamide	DMR2OMU	Discovery agent	N.A.	Investigative	[39]
5,6-Dichloro-N-(3-morpholinopropyl)nicotinamide	DMZL87A	Discovery agent	N.A.	Investigative	[39]
5-Azidomethyl-3-pyrrol-1-yl-oxazolidin-2-one	DM0HO6C	Discovery agent	N.A.	Investigative	[31]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMMI4H3	Discovery agent	N.A.	Investigative	[6]
5-Bromo-4,9-dihydro-3H-beta-carboline	DM2SEFR	Discovery agent	N.A.	Investigative	[6]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one	DMT9FQN	Discovery agent	N.A.	Investigative	[31]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMNRSYA	Discovery agent	N.A.	Investigative	[6]
5-Methoxy-4,9-dihydro-3H-beta-carboline	DMBOMZE	Discovery agent	N.A.	Investigative	[6]
5-Methoxymethyl-3-pyrrol-1-yl-oxazolidin-2-one	DMJ1HX2	Discovery agent	N.A.	Investigative	[31]
6,11-dihydro-5H-benzo[a]carbazole	DMSB8WQ	Discovery agent	N.A.	Investigative	[42]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one	DMU1CV4	Discovery agent	N.A.	Investigative	[43]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMXQ8K1	Discovery agent	N.A.	Investigative	[6]
6-Bromo-4,9-dihydro-3H-beta-carboline	DM64KOZ	Discovery agent	N.A.	Investigative	[6]
6-Chloro-N-(2-morpholinoethyl)nicotinamide	DM10A9S	Discovery agent	N.A.	Investigative	[39]
6-Chloro-N-(3-morpholinopropyl)nicotinamide	DM78I4P	Discovery agent	N.A.	Investigative	[39]
6-Fluoro-N-(2-morpholinoethyl)nicotinamide	DMA1QH0	Discovery agent	N.A.	Investigative	[39]
6-Hydroxy-N-(2-morpholinoethyl)nicotinamide	DM6KVO0	Discovery agent	N.A.	Investigative	[39]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMSA367	Discovery agent	N.A.	Investigative	[33]
6-Methoxy-4,9-dihydro-3H-beta-carboline	DM98FQO	Discovery agent	N.A.	Investigative	[33]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin	DM762G3	Discovery agent	N.A.	Investigative	[47]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin	DMQCDT1	Discovery agent	N.A.	Investigative	[43]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin	DMQMTSX	Discovery agent	N.A.	Investigative	[43]
7-acetonyloxy-3-acetylamino-8-methoxycoumarin	DMYSNQO	Discovery agent	N.A.	Investigative	[45]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMVTH0Q	Discovery agent	N.A.	Investigative	[6]
7-Bromo-4,9-dihydro-3H-beta-carboline	DMCWYT7	Discovery agent	N.A.	Investigative	[6]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMQ1BE8	Discovery agent	N.A.	Investigative	[40]
7-Methoxy-9H-beta-carboline	DMHKMU1	Discovery agent	N.A.	Investigative	[6]
8-(3-Bromobenzyloxy)caffeine	DM2RA4N	Discovery agent	N.A.	Investigative	[48]
8-(3-Chlorobenzyloxy)caffeine	DM7HMNP	Discovery agent	N.A.	Investigative	[48]
8-(3-Fluorobenzyloxy)caffeine	DME85GS	Discovery agent	N.A.	Investigative	[48]
8-(3-Methoxybenzyloxy)caffeine	DMLY46X	Discovery agent	N.A.	Investigative	[48]
8-(3-Methylbenzyloxy)caffeine	DMB9645	Discovery agent	N.A.	Investigative	[48]
8-Benzyloxycaffeine	DMJQ8AP	Discovery agent	N.A.	Investigative	[48]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMALRU4	Discovery agent	N.A.	Investigative	[6]
8-Bromo-4,9-dihydro-3H-beta-carboline	DM4V5RU	Discovery agent	N.A.	Investigative	[6]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMHE7J5	Discovery agent	N.A.	Investigative	[6]
8-Methoxy-4,9-dihydro-3H-beta-carboline	DM8MBSN	Discovery agent	N.A.	Investigative	[6]
8-[(3-Trifluoromethyl)benzyloxy]caffeine	DMT3IOB	Discovery agent	N.A.	Investigative	[48]
9-(3-aminopropoxy)-7H-furo[3,2-g]chromen-7-one	DM51MRV	Discovery agent	N.A.	Investigative	[45]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline	DMF7QS5	Discovery agent	N.A.	Investigative	[6]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[49]
C-(1H-Indol-3-yl)-methylamine	DMDLK9G	Discovery agent	N.A.	Investigative	[6]
CGS-19281A	DMDB2KJ	Discovery agent	N.A.	Investigative	[33]
Cis-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine	DMWX6J0	Discovery agent	N.A.	Investigative	[50]
Cis-2-phenylcyclopropylamine	DMKZ32J	Discovery agent	N.A.	Investigative	[50]
DECYL(DIMETHYL)PHOSPHINE OXIDE	DMQMR3P	Discovery agent	N.A.	Investigative	[14]
Ethyl 4-(2-oxo-2H-chromene-3-carboxamido)benzoate	DMQ3LMF	Discovery agent	N.A.	Investigative	[41]
FA-70	DMDBO89	Major depressive disorder	6A70.3	Investigative	[51]
Flavin-Adenine Dinucleotide	DM5S4GK	Discovery agent	N.A.	Investigative	[52]
HYDRAZINECARBOXAMIDE	DMARWG5	Discovery agent	N.A.	Investigative	[53]
IPRONIAZIDE	DM42ENF	Discovery agent	N.A.	Investigative	[39]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[52]
N'-(2-phenylallyl)hydrazine hydrochloride	DMBR1MX	Discovery agent	N.A.	Investigative	[54]
N-((1H-indol-2-yl)methyl)(phenyl)methanamine	DM093GO	Discovery agent	N.A.	Investigative	[55]
N-((1H-indol-2-yl)methyl)-2-phenylethanamine	DMYUAXR	Discovery agent	N.A.	Investigative	[55]
N-(1-Methyl-1H-indol-2-ylmethyl)-N-phenylamine	DMY3UZH	Discovery agent	N.A.	Investigative	[55]
N-(1H-Indol-2-ylmethyl)-N-(4-phenylbutyl)amine	DMHAGSW	Discovery agent	N.A.	Investigative	[55]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine	DMCM51R	Discovery agent	N.A.	Investigative	[55]
N-(1H-Indol-2-ylmethyl)-N-phenylamine	DMXD592	Discovery agent	N.A.	Investigative	[55]
N-(2-benzyl),N-(1-methylpyrrol-2-ylmethyl)amine	DM72BSO	Discovery agent	N.A.	Investigative	[30]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide	DM3SF5M	Discovery agent	N.A.	Investigative	[44]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine	DM1ADE5	Discovery agent	N.A.	Investigative	[30]
N-(2-Phenylethyl)-1H-indole-2-carboxamide	DMJCO7F	Discovery agent	N.A.	Investigative	[55]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide	DMKAX3Q	Discovery agent	N.A.	Investigative	[55]
N-(3-phenylpropyl)-1H-pyrrole-2-carboxamide	DMZ3I6U	Discovery agent	N.A.	Investigative	[30]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide	DMWTVJH	Discovery agent	N.A.	Investigative	[41]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide	DMTCMUG	Discovery agent	N.A.	Investigative	[55]
N-(4-phenylbutyl)-1H-pyrrole-2-carboxamide	DMSREW5	Discovery agent	N.A.	Investigative	[30]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine	DM87YJW	Discovery agent	N.A.	Investigative	[30]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine	DMTJ5WL	Discovery agent	N.A.	Investigative	[30]
N-2-phenylethyl-1H-pyrrole-2-carboxamide	DM3WTDL	Discovery agent	N.A.	Investigative	[30]
N-Benzyl,N-methyl-1H-indole-2-carboxamide	DMHVRFM	Discovery agent	N.A.	Investigative	[55]
N-benzyl,N-methyl-1H-pyrrole-2-carboxamide	DM8I7N2	Discovery agent	N.A.	Investigative	[30]
N-Benzyl-(6-butoxy-2-naphthyl)-2-aminopropane	DMN9WZ3	Discovery agent	N.A.	Investigative	[26]
N-Benzyl-(6-methoxy-2-naphthyl)-2-aminopropane	DMKJ6F8	Discovery agent	N.A.	Investigative	[26]
N-Benzyl-1H-indole-2-carboxamide	DMA3YWU	Discovery agent	N.A.	Investigative	[55]
N-benzyl-1H-pyrrole-2-carboxamide	DM73ZHV	Discovery agent	N.A.	Investigative	[30]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine	DM0NJAL	Discovery agent	N.A.	Investigative	[55]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine	DM83AEM	Discovery agent	N.A.	Investigative	[30]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine	DMZ24XT	Discovery agent	N.A.	Investigative	[30]
N-Methyl,N-phenyl-1H-indole-2-carboxamide	DMM3B21	Discovery agent	N.A.	Investigative	[55]
N-methyl-N-(prop-2-ynyl)-1H-pyrrole-2-carboxamide	DM796AX	Discovery agent	N.A.	Investigative	[30]
N-Phenyl-1-methyl-1H-indole-2-carboxamide	DM1XV0O	Discovery agent	N.A.	Investigative	[55]
N-Phenyl-1H-indole-2-carboxamide	DM7V025	Discovery agent	N.A.	Investigative	[55]
N-phenyl-1H-pyrrole-2-carboxamide	DMBGIUE	Discovery agent	N.A.	Investigative	[30]
N-propargyl-1H-pyrrole-2-carboxamide	DMNYQ28	Discovery agent	N.A.	Investigative	[30]
N2-[4-(benzyloxy)benzyl]glycinamide	DMOZ1IY	Discovery agent	N.A.	Investigative	[56]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide	DMEWP9L	Discovery agent	N.A.	Investigative	[56]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide	DMLPJGX	Discovery agent	N.A.	Investigative	[56]
NSC-656158	DM52NOI	Discovery agent	N.A.	Investigative	[57]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate	DMHDWTS	Discovery agent	N.A.	Investigative	[36]
PNU-22394	DMHTPSF	Discovery agent	N.A.	Investigative	[6]
TOLOXATONE	DMHV5NK	Discovery agent	N.A.	Investigative	[58]
TRACIZOLINE	DM18CV3	Discovery agent	N.A.	Investigative	[40]
Trans-(+/-)-2-Fluoro-1,2-diphenylcyclopropylamine	DM27TPM	Discovery agent	N.A.	Investigative	[50]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine	DMH1S57	Discovery agent	N.A.	Investigative	[50]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine	DMO01T8	Discovery agent	N.A.	Investigative	[50]
Trans-2-fluoro-2-p-tolylcyclopropanamine	DM392QT	Discovery agent	N.A.	Investigative	[50]
Trans-2-fluoro-2-phenylcyclopropylamin	DMVGAFR	Discovery agent	N.A.	Investigative	[50]
TRYPTOLINE	DMV19K7	Discovery agent	N.A.	Investigative	[40]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Alzheimer's disease	8A00.0	Entorhinal cortex	8.14E-01	0.05	0.1
Vitiligo	EA90	Skin	1.20E-01	-0.43	-1.13
Parkinson's disease	8A00.0	Substantia nigra tissue	6.93E-01	-0.36	-0.41
Major depressive disorder	6A20	Pre-frontal cortex	4.12E-01	-0.02	-0.08

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Monoamine oxidase type A (MAO-A) DME Info
• Gene Name: MAOA

5 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Almotriptan malate	DMFG5ST	N. A.	N. A.	Approved	[59]
Epinephrine	DM3KJBC	Acute asthma	CA23	Approved	[60]
Naratriptan	DMO50U2	Headache	8A80-8A84	Approved	[61]
Safinamide mesylate	DM0J2ZT	Parkinson disease	8A00.0	Approved	[62]
Zolmitriptan	DM1IB4Q	Migraine	8A80	Approved	[63]

3 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benzylamine	DMRM6ES	N. A.	N. A.	Investigative	[64]
PHENETHYLAMINE	DMX0G4F	Discovery agent	N.A.	Investigative	[64]
SEROTONIN	DMOFCRY	Discovery agent	N.A.	Investigative	[64]

References

• [1] Tramadol and another atypical opioid meperidine have exaggerated serotonin syndrome behavioural effects, but decreased analgesic effects, in genetically deficient serotonin transporter (SERT) mice. Int J Neuropsychopharmacol. 2009 Mar 11:1-11.
• [2] Further investigation into the mechanism of tachykinin NK(2) receptor-triggered serotonin release from guinea-pig proximal colon. J Pharmacol Sci. 2009 May;110(1):122-6.
• [3] MAOIs in the contemporary treatment of depression. Neuropsychopharmacology. 1995 May;12(3):185-219.
• [4] Efficacy of citalopram and moclobemide in patients with social phobia: some preliminary findings. Hum Psychopharmacol. 2002 Dec;17(8):401-5.
• [5] Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
• [6] Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.
• [7] Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
• [8] Reversible inhibitors of monoamine oxidase-A (RIMAs): robust, reversible inhibition of human brain MAO-A by CX157. Neuropsychopharmacology. 2010 Feb;35(3):623-31.
• [9] Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
• [10] Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40.
• [11] Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
• [12] Novel monoamine oxidase inhibitors: a patent review (2012 - 2014).Expert Opin Ther Pat. 2015 Jan;25(1):91-110.
• [13] LSD1 inhibitors: a patent review (2010-2015).Expert Opin Ther Pat. 2016 May;26(5):565-80.
• [14] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [15] MAO inhibitors and their wider applications: a patent review.Expert Opin Ther Pat. 2018 Mar;28(3):211-226.
• [16] A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465.
• [17] Befloxatone, a new reversible and selective monoamine oxidase-A inhibitor. II. Pharmacological profile. J Pharmacol Exp Ther. 1996 Apr;277(1):265-77.
• [18] Preclinical profiles of the novel reversible MAO-A inhibitors, moclobemide and brofaromine, in comparison with irreversible MAO inhibitors. J Neural Transm Suppl. 1989;28:5-20.
• [19] Mechanisms of spinal reflex depressant effects of CS-722, a newly synthesized centrally acting muscle relaxant, in spinal rats. Neuropharmacology. 1992 Sep;31(9):949-54.
• [20] MAO-A inhibition in brain after dosing with esuprone, moclobemide and placebo in healthy volunteers: in vivo studies with positron emission tomography. Eur J Clin Pharmacol. 1997;52(2):121-8.
• [21] Stereospecific oxidation of the (S)-enantiomer of RS-8359, a selective and reversible monoamine oxidase A (MAO-A) inhibitor, by aldehyde oxidase. Xenobiotica. 2005 Jun;35(6):561-73.
• [22] Preclinical and early clinical studies with BW 1370U87, a reversible competitive monoamine oxidase-A inhibitor. Clin Neuropharmacol. 1993;16 Suppl 2:S25-33.
• [23] 4-(O-benzylphenoxy)-N-methylbutylamine (bifemelane) and other 4-(O-benzylphenoxy)-N-methylalkylamines as new inhibitors of type A and B monoamine oxidase. J Neurochem. 1988 Jan;50(1):243-7.
• [24] Species differences and mechanism of the epimerization of a new MAO-A inhibitor. Xenobiotica. 1998 Mar;28(3):269-80.
• [25] 2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1388-95.
• [26] Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. Bioorg Med Chem. 2009 Mar 15;17(6):2452-60.
• [27] Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)ox... J Med Chem. 2009 Nov 12;52(21):6685-706.
• [28] Inhibition of monoamine oxidase by (E)-styrylisatin analogues. Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13.
• [29] Novel dual inhibitors of AChE and MAO derived from hydroxy aminoindan and phenethylamine as potential treatment for Alzheimer's disease. J Med Chem. 2002 Nov 21;45(24):5260-79.
• [30] New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. J Med Chem. 2007 Mar 8;50(5):922-31.
• [31] 3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. J Med Chem. 2002 Mar 14;45(6):1180-3.
• [32] Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. Bioorg Med Chem. 2007 Aug 1;15(15):5198-206.
• [33] Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.
• [34] Synthesis of 3-benzyl-2-substituted quinoxalines as novel monoamine oxidase A inhibitors. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1753-6.
• [35] Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70.
• [36] Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9.
• [37] 3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. J Med Chem. 2006 Sep 7;49(18):5578-86.
• [38] Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7.
• [39] Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1659-64.
• [40] Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.
• [41] Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. J Med Chem. 2009 Apr 9;52(7):1935-42.
• [42] Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. J Med Chem. 2007 Nov 1;50(22):5364-71.
• [43] Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. J Med Chem. 2008 Nov 13;51(21):6740-51.
• [44] Inhibition of monoamine oxidase by indole and benzofuran derivatives. Eur J Med Chem. 2010 Oct;45(10):4458-66.
• [45] A QSAR model for in silico screening of MAO-A inhibitors. Prediction, synthesis, and biological assay of novel coumarins. J Med Chem. 2006 Feb 9;49(3):1149-56.
• [46] New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A ... Bioorg Med Chem. 2009 Jan 15;17(2):675-89.
• [47] Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. J Med Chem. 2007 Nov 15;50(23):5848-52.
• [48] Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. Bioorg Med Chem. 2010 Feb;18(3):1018-28.
• [49] Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
• [50] Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases... Bioorg Med Chem. 2008 Aug 1;16(15):7148-66.
• [51] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2489).
• [52] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [53] Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxi... J Med Chem. 2004 Nov 18;47(24):5860-71.
• [54] Design, synthesis, and biological evaluation of semicarbazide-sensitive amine oxidase (SSAO) inhibitors with anti-inflammatory activity. J Med Chem. 2006 Apr 6;49(7):2166-73.
• [55] Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. Bioorg Med Chem. 2008 Nov 15;16(22):9729-40.
• [56] Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoa... J Med Chem. 2007 Oct 4;50(20):4909-16.
• [57] Synthesis and preclinical evaluations of 2-(2-fluorophenyl)-6,7-methylenedioxyquinolin-4-one monosodium phosphate (CHM-1-P-Na) as a potent antitumo... J Med Chem. 2010 Feb 25;53(4):1616-26.
• [58] Quercetin as the active principle of Hypericum hircinum exerts a selective inhibitory activity against MAO-A: extraction, biological analysis, and ... J Nat Prod. 2006 Jun;69(6):945-9.
• [59] Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
• [60] Role of monoamine-oxidase-A-gene variation in the development of glioblastoma in males: a case control study. J Neurooncol. 2019 Nov;145(2):287-294.
• [61] Migraine pharmacotherapy with oral triptans: a rational approach to clinical management. Expert Opin Pharmacother. 2000 Mar;1(3):391-404.
• [62] Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase. J Med Chem. 2007 Oct 4;50(20):4909-16.
• [63] Med-psych drug-drug interactions update. Psychosomatics. 2002 May;43(3):245-7.
• [64] Do monomeric vs dimeric forms of MAO-A make a difference? A direct comparison of the catalytic properties of rat and human MAO-A's. J Neural Transm (Vienna). 2007;114(6):721-4.