Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZ9SOR)

• DTT Name: Muscarinic acetylcholine receptor M1 (CHRM1)
• Synonyms: M1 receptor
• Gene Name: CHRM1
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: ACM1_HUMAN
• TTD ID: T28893
• Sequence:
  MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
  NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
  FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
  QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
  SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
  VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
  KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
  CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
• Function: Primary transducing effect is Pi turnover. The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  cAMP signaling pathway (hsa04024)
  Neuroactive ligand-receptor interaction (hsa04080)
  PI3K-Akt signaling pathway (hsa04151)
  Cholinergic synapse (hsa04725)
  Regulation of actin cytoskeleton (hsa04810)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Muscarinic acetylcholine receptors (R-HSA-390648)

Molecular Interaction Atlas (MIA) of This DTT

15 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ACECLIDINE	DMOLNCZ	Glaucoma/ocular hypertension	9C61	Approved	[2]
Benztropine	DMGZOVN	Parkinson disease	8A00.0	Approved	[3]
Biperiden	DME78OA	Parkinson disease	8A00.0	Approved	[4]
Clidinium	DMUMQZ0	Abdominal stomach pain	DD91.4	Approved	[5]
Cycrimine	DM8C43Q	Parkinson disease	8A00.0	Approved	[6]
Dicyclomine	DMZSDGX	Functional bowel syndrome	DD91.0	Approved	[7]
Diphemanil Methylsulfate	DMXVU6D	Peptic ulcer	DA61	Approved	[8]
Fesoterodine fumarate	DM13495	Overactive bladder	GC50.0	Approved	[9]
Glycopyrrolate	DM2M3ZA	Anaesthesia	9A78.6	Approved	[10]
Metixene	DM0JE6N	Parkinson disease	8A00.0	Approved	[11]
Oxyphenonium	DMMQHOZ	Visceral spasms	MD81.4	Approved	[12]
Pirenzepine	DMP6M1N	Peptic ulcer	DA61	Approved	[1]
Propantheline	DM2EN6G	Excessive sweating	EE00.Z	Approved	[13]
SMT-D002	DM1I93C	Seborrhea	ED91.2	Approved	[14]
Trihexyphenidyl	DMB19L8	Dystonia	8A02	Approved	[15]

17 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nebracetam	DMFD249	Parkinson disease	8A00.0	Phase 3	[16]
(S)-oxybutynin	DMAV426	Urinary incontinence	MF50.2	Phase 2	[17]
FP-1097	DMC1F2T	Urinary incontinence	MF50.2	Phase 2	[18]
N-DESMETHYLCLOZAPINE	DMVIRN3	Schizoaffective disorder	6A21	Phase 2	[19]
NGX-267	DMJKBAY	Schizophrenia	6A20	Phase 2	[20]
SR-46559A	DMW6UA3	Cognitive impairment	6D71	Phase 2	[9]
Xanomeline tartrate	DMXG5WU	Parkinson disease	8A00.0	Phase 2	[20]
AC-262271	DM36WTQ	Glaucoma/ocular hypertension	9C61	Phase 1	[21]
ANAVEX 2-73	DM67OU4	Alzheimer disease	8A20	Phase 1	[22]
ANAVEX 3-71	DM31634	Frontotemporal dementia	6D83	Phase 1	[23]
Arecoline	DMFJZK3	Parkinson disease	8A00.0	Phase 1	[24]
AZD-6088	DM0WCR4	Neuropathic pain	8E43.0	Phase 1	[25]
B7-2/GM-CSF	DM0LKHV	Dementia	6D80-6D86	Phase 1	[26]
MCD-386	DMFIS4D	Alzheimer disease	8A20	Phase 1	[27]
TAK-071	DMKUT08	Alzheimer disease	8A20	Phase 1	[22]
Thiopilocarpine	DMOLFAU	Cognitive impairment	6D71	Phase 1	[28]
WST-057	DM9PNR6	Peripheral neuropathy	8C0Z	Phase 1	[22]

15 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Telenzepine	DM6PVWS	Chronic obstructive pulmonary disease	CA22	Discontinued in Preregistration	[29]
Darotropium	DMJ4WR6	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 2	[26]
Declopramide	DM5QFT4	Inflammatory bowel disease	DD72	Discontinued in Phase 2	[30]
Rispenzepine	DMVHT6F	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 2	[31]
Talsaclidine fumarate	DM2KH9Y	Alzheimer disease	8A20	Discontinued in Phase 2	[20]
YM-796	DMDXP3C	Cognitive impairment	6D71	Discontinued in Phase 2	[32]
PD-151832	DMO34NQ	Parkinson disease	8A00.0	Discontinued in Phase 1/2	[9]
ITAMELINE	DM8139E	Cognitive impairment	6D71	Discontinued in Phase 1	[9]
Sabcomeline	DMCEOAJ	N. A.	N. A.	Discontinued in Phase 1	[20]
SDZ-210-086	DM8BIV4	Cognitive impairment	6D71	Discontinued in Phase 1	[33]
TAZOMELINE	DM5PZ60	Cognitive impairment	6D71	Discontinued in Phase 1	[9]
AC-260584	DMA93D8	Schizophrenia	6A20	Terminated	[20]
Alvameline	DMLN0Y5	Alzheimer disease	8A20	Terminated	[34]
HIMBACINE	DMGAKD8	N. A.	N. A.	Terminated	[35]
WAY-132983	DM2XTB9	N. A.	N. A.	Terminated	[20]

44 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione	DMMNH4K	Discovery agent	N.A.	Investigative	[36]
1,1-diphenyl-2-(3-tropanyl)ethanol	DMZDUSA	Discovery agent	N.A.	Investigative	[37]
1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea	DM9KCXI	Discovery agent	N.A.	Investigative	[38]
2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one	DMAKZ43	Discovery agent	N.A.	Investigative	[39]
2-(4-Diethylamino-but-2-ynyl)-isoindole-1,3-dione	DM823CD	Discovery agent	N.A.	Investigative	[40]
2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime	DM8EV4A	Discovery agent	N.A.	Investigative	[41]
3-(3-benzylamino)-piperidin-2-one	DMYN6Z9	Discovery agent	N.A.	Investigative	[42]
3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one	DME81U3	Discovery agent	N.A.	Investigative	[41]
3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane	DMIH6JU	Discovery agent	N.A.	Investigative	[43]
3alpha-(bis-chloro-phenylmethoxy)tropane	DMBUZWQ	Discovery agent	N.A.	Investigative	[44]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[20]
6-Dimethylamino-2-methyl-hex-4-ynal oxime	DML2AC1	Discovery agent	N.A.	Investigative	[41]
7-Dimethylamino-3-methyl-hept-5-yn-2-one	DMDY2PQ	Discovery agent	N.A.	Investigative	[41]
7-Dimethylamino-hept-5-yn-2-one	DMH782V	Discovery agent	N.A.	Investigative	[41]
7-Pyrrolidin-1-yl-hept-5-yn-2-one	DMQJ26K	Discovery agent	N.A.	Investigative	[41]
A-987306	DMU34BK	Discovery agent	N.A.	Investigative	[45]
Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester	DMVEH40	Discovery agent	N.A.	Investigative	[46]
AF150(S)	DMOYADT	Discovery agent	N.A.	Investigative	[47]
AMINOBENZTROPINE	DMT13EW	Discovery agent	N.A.	Investigative	[48]
Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester	DM6T8YM	Discovery agent	N.A.	Investigative	[49]
Bo(15)PZ	DMCUJH5	Discovery agent	N.A.	Investigative	[50]
BQCA	DMSGIXK	Neurological disorder	6B60	Investigative	[51]
BRL-55473	DMEMZ6Q	Discovery agent	N.A.	Investigative	[52]
CARAMIPEN	DMJFPA9	Discovery agent	N.A.	Investigative	[53]
Cremastrine	DMLJOGK	Discovery agent	N.A.	Investigative	[54]
DAU-5750	DMT14A7	Discovery agent	N.A.	Investigative	[55]
DAU-5884	DMEZVGK	Discovery agent	N.A.	Investigative	[56]
DAU-6202	DMM5SI1	Discovery agent	N.A.	Investigative	[57]
Difluorobenztropine	DM8ABD6	Discovery agent	N.A.	Investigative	[44]
FLUMEZAPINE	DMW0HOG	Discovery agent	N.A.	Investigative	[58]
FM1-10	DM5782Z	Discovery agent	N.A.	Investigative	[59]
FM1-43	DMAP8VY	Discovery agent	N.A.	Investigative	[59]
GNF-PF-5618	DMT8VUS	Discovery agent	N.A.	Investigative	[60]
hexocyclium	DM0HS7L	Discovery agent	N.A.	Investigative	[61]
ISOCLOZAPINE	DM52CPU	Discovery agent	N.A.	Investigative	[62]
ISOLOXAPINE	DMH1BN4	Discovery agent	N.A.	Investigative	[63]
LY-593039	DMQVF41	Discovery agent	N.A.	Investigative	[20]
N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide	DMB3E7H	Discovery agent	N.A.	Investigative	[41]
N-methoxyquinuclidine-3-carboximidoyl chloride	DMMB3PG	Discovery agent	N.A.	Investigative	[52]
N-methoxyquinuclidine-3-carboximidoyl fluoride	DMF8IA6	Discovery agent	N.A.	Investigative	[52]
Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester	DMO325J	Discovery agent	N.A.	Investigative	[49]
R-dimethindene	DM6FVZW	Discovery agent	N.A.	Investigative	[64]
RR(17)PZ	DMP9RLE	Discovery agent	N.A.	Investigative	[50]
SULFOARECOLINE	DM8KYUE	Discovery agent	N.A.	Investigative	[65]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Chronic obstructive pulmonary disease	CA23	Lung tissue	2.09E-01	-0.04	-0.11
Chronic obstructive pulmonary disease	CA23	Small airway epithelium	1.52E-02	-0.06	-0.39
Schizophrenia	6A20	Pre-frontal cortex	8.42E-02	-0.38	-0.24
Schizophrenia	6A20	Superior temporal cortex	2.55E-01	0.14	0.37
Parkinson's disease	8A00.0	Substantia nigra tissue	5.59E-01	0.19	0.41
Alzheimer's disease	8A00.0	Entorhinal cortex	4.61E-07	-0.59	-0.73
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.26E-01	-0.03	-0.16
Type 2 diabetes	5A11	Liver tissue	5.87E-01	0.07	1.02

References

• [1] Negative crosstalk between M1 and M2 muscarinic autoreceptors involves endogenous adenosine activating A1 receptors at the rat motor endplate. Neurosci Lett. 2009 Aug 14;459(3):127-31.
• [2] Design, synthesis, and neurochemical evaluation of 5-(3-alkyl-1,2,4- oxadiazol-5-yl)-1,4,5,6-tetrahydropyrimidines as M1 muscarinic receptor agonists. J Med Chem. 1993 Apr 2;36(7):842-7.
• [3] Formulation and biopharmaceutical evaluation of transdermal patch containing benztropine. Int J Pharm. 2008 Jun 5;357(1-2):55-60.
• [4] Evaluation of in vivo binding properties of 3H-NMPB and 3H-QNB in mouse brain. J Neural Transm. 1999;106(7-8):583-92.
• [5] Accidental acute clidinium toxicity. Emerg Med J. 2009 Jun;26(6):460.
• [6] Capillary gas chromatography of trihexyphenidyl, procyclidine and cycrimine in biological fluids. J Chromatogr. 1989 Sep 29;494:135-42.
• [7] [Characterization of muscarinic receptors in undifferentiated thyroid cells in Fisher rats]. Endocrinol Nutr. 2009 Mar;56(3):106-11.
• [8] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [9] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [10] Autonomic cardiovascular control during a novel pharmacologic alternative to ganglionic blockade. Clin Pharmacol Ther. 2008 May;83(5):692-701.
• [11] Roles of the M1 muscarinic acetylcholine receptor subtype in the regulation of basal ganglia function and implications for the treatment of Parkinson's disease.J Pharmacol Exp Ther.2012 Mar;340(3):595-603.
• [12] Ultraviolet spectroscopic estimation of microenvironments and bitter tastes of oxyphenonium bromide in cyclodextrin solutions. J Pharm Sci. 1999 Aug;88(8):759-62.
• [13] Involvement of the peripheral cholinergic muscarinic system in the compensatory ovarian hypertrophy in the rat. Exp Biol Med (Maywood). 2004 Sep;229(8):793-805.
• [14] Demonstration of bladder selective muscarinic receptor binding by intravesical oxybutynin to treat overactive bladder. J Urol. 2004 Nov;172(5 Pt 1):2059-64.
• [15] The role of M1 muscarinic cholinergic receptors in the discriminative stimulus properties of N-desmethylclozapine and the atypical antipsychotic dr... Psychopharmacology (Berl). 2009 Apr;203(2):295-301.
• [16] Effects of nebracetam (WEB 1881 FU), a novel nootropic, as a M1-muscarinic agonist. Jpn J Pharmacol. 1991 Jan;55(1):177-80.
• [17] Enantiomers of oxybutynin: in vitro pharmacological characterization at M1, M2 and M3 muscarinic receptors and in vivo effects on urinary bladder contraction, mydriasis and salivary secretion in guinea pigs. J Pharmacol Exp Ther. 1991 Feb;256(2):562-7.
• [18] Clinical pipeline report, company report or official report of FemmePharma.
• [19] N-desmethylclozapine, a major metabolite of clozapine, increases cortical acetylcholine and dopamine release in vivo via stimulation of M1 muscarin... Neuropsychopharmacology. 2005 Nov;30(11):1986-95.
• [20] Pharmacological comparison of muscarinic ligands: historical versus more recent muscarinic M1-preferring receptor agonists. Eur J Pharmacol. 2009 Mar 1;605(1-3):53-6.
• [21] Phase I clinical trial of muscarinic agonist (AC-262271) for treating glaucoma. Acadia Pharmaceuticals.
• [22] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [23] AF710B, an M1/sigma-1 receptor agonist with long-lasting disease-modifying properties in a transgenic rat model of Alzheimer's disease. Alzheimers Dement. 2018 Jun;14(6):811-823.
• [24] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [25] Evaluation of an Innovative Population Pharmacokinetic-Based Design for Behavioral Pharmacodynamic Endpoints. AAPS J. 2012 December; 14(4): 657-663.
• [26] Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
• [27] The processing of the selective M1 agonist CDD-0102-J by human hepatic drug metabolizing enzymes. Am J Ther. 2005 Jul-Aug;12(4):300-5.
• [28] SDZ ENS 163, a selective muscarinic M1 receptor agonist, facilitates the induction of long-term potentiation in rat hippocampal slices. Eur J Pharmacol. 1992 Nov 3;222(1):21-5.
• [29] Effect of telenzepine, an M1-selective muscarinic receptor antagonist, in patients with nocturnal asthma. Pulm Pharmacol. 1994 Apr;7(2):91-7.
• [30] Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88.
• [31] Evidence for prejunctional muscarinic autoreceptors in human and guinea pig trachea. Am J Respir Crit Care Med. 1995 Sep;152(3):872-8.
• [32] YM796, a novel muscarinic agonist, improves the impairment of learning behavior in a rat model of chronic focal cerebral ischemia. Brain Res. 1995 Jan 9;669(1):107-14.
• [33] Influence of the cholinergic agonist SDZ 210-086 on sleep in healthy subjects. Neuropsychopharmacology. 1993 Nov;9(3):225-32.
• [34] In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40.
• [35] Himbacine analogs as muscarinic receptor antagonists--effects of tether and heterocyclic variations. Bioorg Med Chem Lett. 2004 Aug 2;14(15):3967-70.
• [36] Synthesis and biological evaluation of [125I]- and [123I]-4-iododexetimide, a potent muscarinic cholinergic receptor antagonist. J Med Chem. 1989 May;32(5):1057-62.
• [37] Discovery of (3-endo)-3-(2-cyano-2,2-diphenylethyl)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane bromide as an efficacious inhaled muscarinic acetylch... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4560-2.
• [38] Urea and 2-imidazolidone derivatives of the muscarinic agents oxotremorine and N-methyl-N-(1-methyl-4-pyrrolidino-2-butynyl)acetamide. J Med Chem. 1992 Aug 21;35(17):3270-9.
• [39] Synthesis and modeling studies of a potent conformationally rigid muscarinic agonist: 1-azabicyclo[2.2.1]heptanespirofuranone. J Med Chem. 1998 Oct 22;41(22):4181-5.
• [40] Design of dual acting anticonvulsant-antimuscarinic succinimide and hydantoin derivatives, Bioorg. Med. Chem. Lett. 7(8):979-984 (1997).
• [41] Cholinergic agents: aldehyde, ketone, and oxime analogues of the muscarinic agonist UH5, Bioorg. Med. Chem. Lett. 2(8):803-808 (1992).
• [42] Designing active template molecules by combining computational de novo design and human chemist's expertise. J Med Chem. 2007 Apr 19;50(8):1925-32.
• [43] Synthesis and muscarinic activities of quinuclidin-3-yltriazole and -tetrazole derivatives. J Med Chem. 1992 Apr 3;35(7):1280-90.
• [44] Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogue... J Med Chem. 2006 Oct 19;49(21):6391-9.
• [45] cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8.
• [46] 6beta-Acetoxynortropane: a potent muscarinic agonist with apparent selectivity toward M2-receptors. J Med Chem. 1998 Jun 4;41(12):2047-55.
• [47] M1 muscarinic agonists target major hallmarks of Alzheimer's disease--an update. Curr Alzheimer Res. 2007 Dec;4(5):577-80.
• [48] 3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile. J Med Chem. 1997 Mar 14;40(6):851-7.
• [49] 6beta-Acyloxy(nor)tropanes: affinities for antagonist/agonist binding sites on transfected and native muscarinic receptors. J Med Chem. 2000 Jun 29;43(13):2514-22.
• [50] On the use of nonfluorescent dye labeled ligands in FRET-based receptor binding studies. J Med Chem. 2005 Dec 1;48(24):7847-59.
• [51] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5436).
• [52] A novel and selective class of azabicyclic muscarinic agonists incorporating an N-methoxy imidoyl halide or nitrile functionality, Bioorg. Med. Chem. Lett. 2(8):791-796 (1992).
• [53] Muscarinic receptor binding profile of para-substituted caramiphen analogues. J Med Chem. 1991 Oct;34(10):2984-9.
• [54] Cremastrine, a pyrrolizidine alkaloid from Cremastra appendiculata. J Nat Prod. 2005 Apr;68(4):572-3.
• [55] Synthesis, absolute configuration, conformational analysis and binding affinity properties of enantiomeric forms of DAU 5750, a novel M1-M3 muscari... Bioorg Med Chem. 1994 Dec;2(12):1375-83.
• [56] Doi: 10.1038/bjp.2008.208
• [57] Characterization of muscarinic receptors in guinea-pig uterus. Eur J Pharmacol. 1993 Dec 7;250(2):223-30.
• [58] Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. J Med Chem. 1989 Dec;32(12):2573-82.
• [59] Design and synthesis of a fluorescent muscarinic antagonist. Bioorg Med Chem Lett. 2008 Jan 15;18(2):825-7.
• [60] Nocardimicins A, B, C, D, E, and F, siderophores with muscarinic M3 receptor inhibiting activity from Nocardia sp. TP-A0674. J Nat Prod. 2005 Jul;68(7):1061-5.
• [61] Hexocyclium derivatives with a high selectivity for smooth muscle muscarinic receptors. Br J Pharmacol. 1990 May;100(1):150-2.
• [62] Chloro-substituted, sterically hindered 5,11-dicarbo analogues of clozapine as potential chiral antipsychotic agents. J Med Chem. 1990 Feb;33(2):809-14.
• [63] Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6.
• [64] Characterization of novel selective H1-antihistamines for clinical evaluation in the treatment of insomnia. J Med Chem. 2009 Sep 10;52(17):5307-10.
• [65] Heterocyclic muscarinic agonists. Synthesis and biological activity of some bicyclic sulfonium arecoline bioisosteres. J Med Chem. 1988 Jul;31(7):1312-6.