Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOA4HTH)

DOT Name Aldo-keto reductase family 1 member B10 (AKR1B10)
Synonyms EC 1.1.1.300; EC 1.1.1.54; ARL-1; Aldose reductase-like; Aldose reductase-related protein; ARP; hARP; Small intestine reductase; SI reductase
Gene Name AKR1B10
UniProt ID
AK1BA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1ZUA; 4GA8; 4GAB; 4GQ0; 4GQG; 4I5X; 4ICC; 4JIH; 4JII; 4WEV; 4XZL; 4XZM; 4XZN; 5LIK; 5LIU; 5LIW; 5LIX; 5LIY; 5M2F; 5Y7N
EC Number
1.1.1.300; 1.1.1.54
Pfam ID
PF00248
Sequence
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
Function
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays strong enzymatic activity toward all-trans-retinal, 9-cis-retinal, and 13-cis-retinal. Plays a critical role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls). Displays no reductase activity towards glucose.
Tissue Specificity Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
KEGG Pathway
Pentose and glucuro.te interconversions (hsa00040 )
Fructose and mannose metabolism (hsa00051 )
Galactose metabolism (hsa00052 )
Glycerolipid metabolism (hsa00561 )
Folate biosynthesis (hsa00790 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Retinoid metabolism and transport (R-HSA-975634 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Aldo-keto reductase family 1 member B10 (AKR1B10) decreases the response to substance of Arsenic trioxide. [44]
Daunorubicin DMQUSBT Approved Aldo-keto reductase family 1 member B10 (AKR1B10) decreases the response to substance of Daunorubicin. [45]
Vitamin A DMJ2AH4 Approved Aldo-keto reductase family 1 member B10 (AKR1B10) decreases the response to substance of Vitamin A. [46]
crotylaldehyde DMTWRQI Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) decreases the response to substance of crotylaldehyde. [49]
acrolein DMAMCSR Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) decreases the response to substance of acrolein. [50]
------------------------------------------------------------------------------------
This DOT Affected the Biotransformations of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
3-Hydroxy-2-butanone DM9GPKR Patented Aldo-keto reductase family 1 member B10 (AKR1B10) increases the reduction of 3-Hydroxy-2-butanone. [47]
Farnesol DMV2X1B Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) increases the chemical synthesis of Farnesol. [51]
Indan-1-ol DMMLQZJ Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) increases the oxidation of Indan-1-ol. [43]
------------------------------------------------------------------------------------
This DOT Affected the Regulation of Drug Effects of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
4-hydroxy-2-nonenal DM2LJFZ Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) increases the metabolism of 4-hydroxy-2-nonenal. [48]
All-trans-retinal DM6CEVB Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) increases the metabolism of All-trans-retinal. [52]
2,3-dihydroxypropanal DMOWNB4 Investigative Aldo-keto reductase family 1 member B10 (AKR1B10) increases the metabolism of 2,3-dihydroxypropanal. [22]
------------------------------------------------------------------------------------
70 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [9]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [12]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [13]
Progesterone DMUY35B Approved Progesterone decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [14]
Menadione DMSJDTY Approved Menadione increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [11]
Fluorouracil DMUM7HZ Approved Fluorouracil affects the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [15]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [16]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [17]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [18]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [20]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [22]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [23]
Vitamin C DMXJ7O8 Approved Vitamin C increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
Ampicillin DMHWE7P Approved Ampicillin decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [9]
Isoniazid DM5JVS3 Approved Isoniazid increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [24]
Clavulanate DM2FGRT Approved Clavulanate increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [25]
Chlorambucil DMRKE63 Approved Chlorambucil decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
Benzoic acid DMKB9FI Approved Benzoic acid increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
Flucloxacillin DMNUWST Approved Flucloxacillin increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [24]
Reserpine DM6VM38 Approved Reserpine increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
Gemfibrozil DMD8Q3J Approved Gemfibrozil decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [22]
Amoxicillin DMUYNEI Approved Amoxicillin increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [24]
Ciprofibrate DMGC5DB Approved Ciprofibrate decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [22]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [26]
Phenol DM1QSM3 Phase 2/3 Phenol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [25]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [27]
Disulfiram DMCL2OK Phase 2 Trial Disulfiram increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [28]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [29]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [30]
Eugenol DM7US1H Patented Eugenol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
ZOPOLRESTAT DMWOT92 Discontinued in Phase 2 ZOPOLRESTAT decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [22]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [16]
PIRINIXIC ACID DM82Y75 Preclinical PIRINIXIC ACID increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [19]
EMODIN DMAEDQG Terminated EMODIN decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [31]
Sorbinil DM31VE4 Terminated Sorbinil decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [22]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [32]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [33]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [34]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [35]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [36]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [37]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [9]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [20]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [38]
U0126 DM31OGF Investigative U0126 decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [30]
Chrysin DM7V2LG Investigative Chrysin decreases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [30]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [38]
Aloe-emodin DMPTY8S Investigative Aloe-emodin decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [31]
Phenanthrene-9,10-dione DMG8KS9 Investigative Phenanthrene-9,10-dione increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [39]
methyl salicylate DMKCG8H Investigative methyl salicylate increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
2-Propanol, Isopropanol DML5O0H Investigative 2-Propanol, Isopropanol increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [21]
Caffeic acid phenethyl ester DMRJKIV Investigative Caffeic acid phenethyl ester decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [40]
Hydroxybenzo(a)pyrene DM9H5EN Investigative Hydroxybenzo(a)pyrene increases the expression of Aldo-keto reductase family 1 member B10 (AKR1B10). [41]
pCMPS DMGIS5Q Investigative pCMPS decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [42]
4-oxo-nonenal DMPX1J9 Investigative 4-oxo-nonenal decreases the activity of Aldo-keto reductase family 1 member B10 (AKR1B10). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 70 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
7 Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
8 Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 Proteomic analysis of hepatic effects of phenobarbital in mice with humanized liver. Arch Toxicol. 2022 Oct;96(10):2739-2754. doi: 10.1007/s00204-022-03338-7. Epub 2022 Jul 26.
14 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
15 Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
16 Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29. Chem Biol Interact. 2011 May 30;191(1-3):239-49.
17 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
18 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
19 Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
20 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
21 Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
22 Inhibiting wild-type and C299S mutant AKR1B10; a homologue of aldose reductase upregulated in cancers. Eur J Pharmacol. 2008 Apr 28;584(2-3):213-21.
23 Identification of approved drugs as potent inhibitors of pregnane X receptor activation with differential receptor interaction profiles. Arch Toxicol. 2018 Apr;92(4):1435-1451.
24 Characterization of drug-specific signaling between primary human hepatocytes and immune cells. Toxicol Sci. 2017 Jul 1;158(1):76-89.
25 Molecular mechanisms of hepatotoxic cholestasis by clavulanic acid: Role of NRF2 and FXR pathways. Food Chem Toxicol. 2021 Dec;158:112664. doi: 10.1016/j.fct.2021.112664. Epub 2021 Nov 9.
26 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
27 Down-regulation of aldo-keto reductase AKR1B10 gene expression by a phorbol ester via the ERK/c-Jun signaling pathway. Chem Biol Interact. 2015 Jun 5;234:274-81.
28 Benzo[a]pyrene and glycine N-methyltransferse interactions: gene expression profiles of the liver detoxification pathway. Toxicol Appl Pharmacol. 2006 Jul 15;214(2):126-35.
29 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
30 Chrysin enhances sensitivity of BEL-7402/ADM cells to doxorubicin by suppressing PI3K/Akt/Nrf2 and ERK/Nrf2 pathway. Chem Biol Interact. 2013 Oct 25;206(1):100-8.
31 Inhibition of human carbonyl reducing enzymes by plant anthrone and anthraquinone derivatives. Chem Biol Interact. 2022 Feb 25;354:109823. doi: 10.1016/j.cbi.2022.109823. Epub 2022 Jan 21.
32 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
33 Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
34 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
35 Transcriptomic responses of cancerous and noncancerous human colon cells to sulforaphane and selenium. Chem Res Toxicol. 2014 Mar 17;27(3):377-86.
36 Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
37 An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
38 The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
39 Exposure to 9,10-phenanthrenequinone accelerates malignant progression of lung cancer cells through up-regulation of aldo-keto reductase 1B10. Toxicol Appl Pharmacol. 2014 Jul 15;278(2):180-9.
40 Initro CAPE inhibitory activity towards human AKR1C3 and the molecular basis. Chem Biol Interact. 2016 Jun 25;253:60-5.
41 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
42 Modulation of activity and inhibitor sensitivity of rabbit aldose reductase-like protein (AKR1B19) by oxidized glutathione and SH-reagents. Chem Biol Interact. 2013 Feb 25;202(1-3):146-52.
43 Role of human aldo-keto-reductase AKR1B10 in the protection against toxic aldehydes. Chem Biol Interact. 2009 Mar 16;178(1-3):145-50.
44 The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.
45 Cancer biomarker AKR1B10 and carbonyl metabolism. Chem Biol Interact. 2009 Mar 16;178(1-3):134-7. doi: 10.1016/j.cbi.2008.10.044. Epub 2008 Nov 5.
46 Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels. Chem Biol Interact. 2009 Mar 16;178(1-3):171-7. doi: 10.1016/j.cbi.2008.10.027. Epub 2008 Oct 25.
47 Biocatalytic production of alpha-hydroxy ketones and vicinal diols by yeast and human aldo-keto reductases. Chem Biol Interact. 2013 Feb 25;202(1-3):195-203.
48 Aldo-keto reductase 1B10 promotes development of cisplatin resistance in gastrointestinal cancer cells through down-regulating peroxisome proliferator-activated receptor--dependent mechanism. Chem Biol Interact. 2016 Aug 25;256:142-53. doi: 10.1016/j.cbi.2016.07.008. Epub 2016 Jul 11.
49 Aldo-keto reductase family 1 B10 gene silencing results in growth inhibition of colorectal cancer cells: Implication for cancer intervention. Int J Cancer. 2007 Nov 15;121(10):2301-6. doi: 10.1002/ijc.22933.
50 Reduced 293T cell susceptibility to acrolein due to aldose reductase-like-1 protein expression. Toxicol Sci. 2007 Jun;97(2):562-8. doi: 10.1093/toxsci/kfm033. Epub 2007 Feb 27.
51 Roles of rat and human aldo-keto reductases in metabolism of farnesol and geranylgeraniol. Chem Biol Interact. 2011 May 30;191(1-3):261-8. doi: 10.1016/j.cbi.2010.12.017. Epub 2010 Dec 25.
52 Human and rodent aldo-keto reductases from the AKR1B subfamily and their specificity with retinaldehyde. Chem Biol Interact. 2011 May 30;191(1-3):199-205. doi: 10.1016/j.cbi.2011.02.007. Epub 2011 Feb 15.