General Information of Drug (ID: DM1I3D5)

Drug Name
Lepirudin
Synonyms
Refludan; Refludin; Aventis Behring Brand of Lepirudin; Aventis Brand Lepirudin; Aventis Pharma Brand of Lepirudin; Berlex Brand of Lepirudin; Hoechst Brand of Lepirudin; Lepirudin recombinant; Pharmion Brand of Lepirudin; Schering Brand of Lepirudin; Hbw 023; Hbw-023; 1-L-Leucine-2-L-threonine-63-desulfohirudin (Hirudomedicinalis isoform HV1); 1-Leu-2-thr-63-desulfohirudin
Indication
Disease Entry ICD 11 Status REF
Thrombocytopenia 3B64 Approved [1]
Therapeutic Class
Antithrombotic Agents
Affected Organisms
Humans and other mammals
ATC Code
B01AE02: Lepirudin
B01AE: Direct thrombin inhibitors
B01A: ANTITHROMBOTIC AGENTS
B01: ANTITHROMBOTIC AGENTS
B: BLOOD AND BLOOD FORMING ORGANS
Drug Type
Small molecular drug
Sequence
LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIP
EEYLQ
Structure
3D MOL is unavailable 2D MOL
#Ro5 Violations (Lipinski): 5 Molecular Weight (mw) 6979
Logarithm of the Partition Coefficient (xlogp) -41.3
Rotatable Bond Count (rotbonds) 166
Hydrogen Bond Donor Count (hbonddonor) 100
Hydrogen Bond Acceptor Count (hbondacc) 122
ADMET Property
Bioavailability
The bioavailability of drug is 100% []
Half-life
The concentration or amount of drug in body reduced by one-half in 1.3 hours [2]
Metabolism
The drug is metabolized via release of amino acids via catabolic hydrolysis of the parent drug []
Vd
The volume of distribution (Vd) of drug is 12.2 L []
Chemical Identifiers
Formula
C287H440N80O111S6
IUPAC Name
(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2S,3R)-2-[[2-[[(2S)-2-[[2-[[(2S,3R)-2-[[(2S)-2-[[(1R,6R,9S,12S,15S,18S,24S,27S,33S,36S,39R,44R,47S,53S,56S,59S,67S,73S,76S)-15,76-bis(4-aminobutyl)-44-[[(2S)-2-[[(4R,7S,10S,13S,19S,22S,25S,28R)-28-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-amino-4-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxybutanoyl]amino]-3-carboxypropanoyl]amino]-10-(2-amino-2-oxoethyl)-13-(3-amino-3-oxopropyl)-22-(2-carboxyethyl)-25-[(1R)-1-hydroxyethyl]-19-(hydroxymethyl)-7-(2-methylpropyl)-6,9,12,15,18,21,24,27-octaoxo-1,2-dithia-5,8,11,14,17,20,23,26-octazacyclononacosane-4-carbonyl]amino]-4-methylpentanoyl]amino]-12,56,73-tris(2-amino-2-oxoethyl)-9,67-bis(3-amino-3-oxopropyl)-36-[(2S)-butan-2-yl]-18,47-bis(2-carboxyethyl)-24-(carboxymethyl)-27,53-bis(hydroxymethyl)-33-(2-methylpropyl)-8,11,14,17,20,23,26,29,32,35,38,45,48,51,54,57,60,62,65,68,71,74,77-tricosaoxo-59-propan-2-yl-3,4,41,42-tetrathia-7,10,13,16,19,22,25,28,31,34,37,46,49,52,55,58,61,63,66,69,72,75,78-tricosazabicyclo[37.22.17]octaheptacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-3-hydroxybutanoyl]amino]acetyl]amino]-4-carboxybutanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-carboxypropanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbonyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoic acid
Canonical SMILES
CC[C@H](C)[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@H]2C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N2)C(C)C)CC(=O)N)CO)CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]3CSSC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N3)CC(C)C)CC(=O)N)CCC(=O)N)CO)CCC(=O)O)[C@@H](C)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)N)C(=O)N1)CCCCN)CC(=O)N)CCC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N5CCC[C@H]5C(=O)N[C@@H](CCCCN)C(=O)N6CCC[C@H]6C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC7=CNC=N7)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC8=CC=CC=C8)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N9CCC[C@H]9C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)CCC(=O)N)CC(=O)N)CCCCN)CCC(=O)O)CC(=O)O)CO)CC(C)C
InChI
InChI=1S/C287H440N80O111S6/c1-24-132(17)225-280(470)345-162(87-126(5)6)236(426)306-111-209(396)320-181(116-370)267(457)344-176(101-220(416)417)238(428)307-105-203(390)316-152(61-74-213(402)403)243(433)321-146(40-29-32-80-288)241(431)339-171(96-198(298)385)259(449)326-153(56-69-194(294)381)250(440)351-186(121-482-479-118-183-240(430)310-107-202(389)313-148(54-67-192(292)379)233(423)303-108-206(393)317-170(95-197(297)384)258(448)322-147(41-30-33-81-289)242(432)350-187(272(462)359-225)122-483-480-119-184(269(459)323-150(60-73-212(400)401)235(425)304-110-208(395)319-180(115-369)266(456)342-174(99-201(301)388)265(455)357-223(130(13)14)278(468)355-183)352-254(444)165(90-129(11)12)335-270(460)185-120-481-484-123-188(354-263(453)178(103-222(420)421)347-283(473)230(137(22)375)362-264(454)168(93-141-48-52-144(378)53-49-141)346-282(472)228(135(20)373)361-232(422)145(291)86-125(3)4)273(463)363-229(136(21)374)281(471)330-158(65-78-217(410)411)249(439)348-179(114-368)239(429)309-106-204(391)315-151(55-68-193(293)380)244(434)340-172(97-199(299)386)260(450)334-164(89-128(9)10)253(443)353-185)271(461)358-224(131(15)16)279(469)364-227(134(19)372)277(467)311-112-205(392)314-149(59-72-211(398)399)234(424)305-113-210(397)356-231(138(23)376)286(476)367-85-37-45-191(367)276(466)331-160(42-31-34-82-290)284(474)365-83-35-43-189(365)274(464)328-154(57-70-195(295)382)248(438)349-182(117-371)268(458)338-169(94-142-104-302-124-312-142)257(447)341-173(98-200(300)387)261(451)343-175(100-219(414)415)237(427)308-109-207(394)318-177(102-221(418)419)262(452)337-166(91-139-38-27-26-28-39-139)255(445)327-155(62-75-214(404)405)245(435)325-159(66-79-218(412)413)251(441)360-226(133(18)25-2)285(475)366-84-36-44-190(366)275(465)329-157(64-77-216(408)409)246(436)324-156(63-76-215(406)407)247(437)336-167(92-140-46-50-143(377)51-47-140)256(446)333-163(88-127(7)8)252(442)332-161(287(477)478)58-71-196(296)383/h26-28,38-39,46-53,104,124-138,145-191,223-231,368-378H,24-25,29-37,40-45,54-103,105-123,288-291H2,1-23H3,(H2,292,379)(H2,293,380)(H2,294,381)(H2,295,382)(H2,296,383)(H2,297,384)(H2,298,385)(H2,299,386)(H2,300,387)(H2,301,388)(H,302,312)(H,303,423)(H,304,425)(H,305,424)(H,306,426)(H,307,428)(H,308,427)(H,309,429)(H,310,430)(H,311,467)(H,313,389)(H,314,392)(H,315,391)(H,316,390)(H,317,393)(H,318,394)(H,319,395)(H,320,396)(H,321,433)(H,322,448)(H,323,459)(H,324,436)(H,325,435)(H,326,449)(H,327,445)(H,328,464)(H,329,465)(H,330,471)(H,331,466)(H,332,442)(H,333,446)(H,334,450)(H,335,460)(H,336,437)(H,337,452)(H,338,458)(H,339,431)(H,340,434)(H,341,447)(H,342,456)(H,343,451)(H,344,457)(H,345,470)(H,346,472)(H,347,473)(H,348,439)(H,349,438)(H,350,432)(H,351,440)(H,352,444)(H,353,443)(H,354,453)(H,355,468)(H,356,397)(H,357,455)(H,358,461)(H,359,462)(H,360,441)(H,361,422)(H,362,454)(H,363,463)(H,364,469)(H,398,399)(H,400,401)(H,402,403)(H,404,405)(H,406,407)(H,408,409)(H,410,411)(H,412,413)(H,414,415)(H,416,417)(H,418,419)(H,420,421)(H,477,478)/t132-,133-,134+,135+,136+,137+,138+,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,183-,184-,185-,186-,187-,188-,189-,190-,191-,223-,224-,225-,226-,227-,228-,229-,230-,231-/m0/s1
InChIKey
FIBJDTSHOUXTKV-BRHMIFOHSA-N
Cross-matching ID
PubChem CID
118856773
ChEBI ID
CHEBI:142437
CAS Number
138068-37-8
UNII
Y43GF64R34
DrugBank ID
DB00001
TTD ID
D09LPN

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Coagulation factor IIa (F2) TT6L509 THRB_HUMAN Inhibitor [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Lepirudin
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Bivalirudin DMECRX1 Major Increased risk of bleeding by the combination of Lepirudin and Bivalirudin. Thrombocytopenia [3B64] [4]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Lepirudin and Caplacizumab. Thrombocytopenia [3B64] [5]
Coadministration of a Drug Treating the Disease Different from Lepirudin (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Abciximab DMJO6GV Major Increased risk of bleeding by the combination of Lepirudin and Abciximab. Angina pectoris [BA40] [6]
Eptifibatide DMQXTJS Major Increased risk of bleeding by the combination of Lepirudin and Eptifibatide. Angina pectoris [BA40] [6]
Cilostazol DMZMSCT Major Increased risk of bleeding by the combination of Lepirudin and Cilostazol. Arterial occlusive disease [BD40] [6]
Vitamin E DMZC90K Moderate Increased risk of bleeding by the combination of Lepirudin and Vitamin E. Cardiovascular disease [BA00-BE2Z] [7]
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Lepirudin and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [8]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Lepirudin and Pentosan polysulfate. Chronic pain [MG30] [9]
Phenylbutazone DMAYL0T Moderate Increased risk of bleeding by the combination of Lepirudin and Phenylbutazone. Chronic pain [MG30] [6]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Lepirudin and Ketoprofen. Chronic pain [MG30] [6]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Lepirudin and Levomilnacipran. Chronic pain [MG30] [10]
Anisindione DM2C48U Major Increased risk of bleeding by the combination of Lepirudin and Anisindione. Coagulation defect [3B10] [11]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Lepirudin and Regorafenib. Colorectal cancer [2B91] [12]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Lepirudin and Intedanib. Colorectal cancer [2B91] [13]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Lepirudin and Ardeparin. Coronary thrombosis [BA43] [14]
Danaparoid DM6CLBN Major Increased risk of bleeding by the combination of Lepirudin and Danaparoid. Deep vein thrombosis [BD71] [14]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Lepirudin and Rivaroxaban. Deep vein thrombosis [BD71] [15]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Lepirudin and Sertraline. Depression [6A70-6A7Z] [10]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Lepirudin and Fluoxetine. Depression [6A70-6A7Z] [10]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Lepirudin and Vilazodone. Depression [6A70-6A7Z] [10]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Lepirudin and Paroxetine. Depression [6A70-6A7Z] [10]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Lepirudin and Vortioxetine. Depression [6A70-6A7Z] [10]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Lepirudin and Duloxetine. Depression [6A70-6A7Z] [10]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Lepirudin and Milnacipran. Depression [6A70-6A7Z] [10]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Lepirudin and Escitalopram. Depression [6A70-6A7Z] [10]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Lepirudin and Desvenlafaxine. Depression [6A70-6A7Z] [10]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Lepirudin and Clomipramine. Depression [6A70-6A7Z] [10]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Lepirudin and Fluvoxamine. Depression [6A70-6A7Z] [10]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Lepirudin and Venlafaxine. Depression [6A70-6A7Z] [10]
Heme DMGC287 Moderate Increased risk of bleeding by the combination of Lepirudin and Heme. Discovery agent [N.A.] [16]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Lepirudin and Apigenin. Discovery agent [N.A.] [17]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Lepirudin and Citalopram derivative 1. Discovery agent [N.A.] [10]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Lepirudin and PMID28870136-Compound-49. Discovery agent [N.A.] [18]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Lepirudin and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [10]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Lepirudin and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [19]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Lepirudin and Mefenamic acid. Female pelvic pain [GA34] [6]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Lepirudin and Avapritinib. Gastrointestinal stromal tumour [2B5B] [12]
Sulfinpyrazone DMEV954 Major Increased risk of bleeding by the combination of Lepirudin and Sulfinpyrazone. Gout [FA25] [6]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Lepirudin and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [20]
Dipyridamole DMXY30O Major Increased risk of bleeding by the combination of Lepirudin and Dipyridamole. Hypertension [BA00-BA04] [6]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Lepirudin and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [6]
Ticlopidine DMO946V Major Increased risk of bleeding by the combination of Lepirudin and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [6]
Tositumomab DMMYZ3D Major Increased risk of bleeding by the combination of Lepirudin and Tositumomab. Malignant haematopoietic neoplasm [2B33] [21]
Alemtuzumab DMZL3IV Moderate Increased risk of bleeding by the combination of Lepirudin and Alemtuzumab. Mature B-cell leukaemia [2A82] [5]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Lepirudin and Acalabrutinib. Mature B-cell lymphoma [2A85] [22]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Lepirudin and Ibrutinib. Mature B-cell lymphoma [2A85] [23]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Lepirudin and Ponatinib. Mature B-cell lymphoma [2A85] [24]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Lepirudin and Panobinostat. Multiple myeloma [2A83] [5]
Fedratinib DM4ZBK6 Major Increased risk of bleeding by the combination of Lepirudin and Fedratinib. Myeloproliferative neoplasm [2A20] [6]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Lepirudin and Dasatinib. Myeloproliferative neoplasm [2A20] [25]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Lepirudin and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [9]
Urokinase DM0GOUD Major Increased risk of bleeding by the combination of Lepirudin and Urokinase. Myocardial infarction [BA41-BA43] [26]
Anistreplase DM6Q4B0 Major Increased risk of bleeding by the combination of Lepirudin and Anistreplase. Myocardial infarction [BA41-BA43] [26]
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Lepirudin and Prasugrel. Myocardial infarction [BA41-BA43] [12]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Lepirudin and Vorapaxar. Myocardial infarction [BA41-BA43] [27]
Tenecteplase DMJYN25 Major Increased risk of bleeding by the combination of Lepirudin and Tenecteplase. Myocardial infarction [BA41-BA43] [26]
Reteplase DML0D1P Major Increased risk of bleeding by the combination of Lepirudin and Reteplase. Myocardial infarction [BA41-BA43] [26]
Tirofiban DMQG17S Major Increased risk of bleeding by the combination of Lepirudin and Tirofiban. Myocardial infarction [BA41-BA43] [6]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Lepirudin and Sibutramine. Obesity [5B80-5B81] [28]
Dexfenfluramine DMJ7YDS Moderate Increased risk of bleeding by the combination of Lepirudin and Dexfenfluramine. Obesity [5B80-5B81] [28]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Lepirudin and Diclofenac. Osteoarthritis [FA00-FA05] [6]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Lepirudin and Nepafenac. Osteoarthritis [FA00-FA05] [19]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Lepirudin and Naproxen. Osteoarthritis [FA00-FA05] [6]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Lepirudin and MK-4827. Ovarian cancer [2C73] [12]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Lepirudin and Aspirin. Pain [MG30-MG3Z] [6]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Lepirudin and Etodolac. Pain [MG30-MG3Z] [6]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Lepirudin and Diflunisal. Pain [MG30-MG3Z] [6]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Lepirudin and Ibuprofen. Pain [MG30-MG3Z] [6]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Lepirudin and Nabumetone. Pain [MG30-MG3Z] [6]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Lepirudin and Piroxicam. Pain [MG30-MG3Z] [6]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Lepirudin and Choline salicylate. Postoperative inflammation [1A00-CA43] [29]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Lepirudin and Ketorolac. Postoperative inflammation [1A00-CA43] [6]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Lepirudin and Bromfenac. Postoperative inflammation [1A00-CA43] [6]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Lepirudin and Treprostinil. Pulmonary hypertension [BB01] [30]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Lepirudin and Epoprostenol. Pulmonary hypertension [BB01] [30]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Lepirudin and Iloprost. Pulmonary hypertension [BB01] [30]
Alteplase DMRJ3YX Major Increased risk of bleeding by the combination of Lepirudin and Alteplase. Pulmonary thromboembolism [BB00] [26]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Lepirudin and Salsalate. Rheumatoid arthritis [FA20] [31]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Lepirudin and Meloxicam. Rheumatoid arthritis [FA20] [6]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Lepirudin and Sulindac. Rheumatoid arthritis [FA20] [6]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Lepirudin and Oxaprozin. Rheumatoid arthritis [FA20] [6]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Lepirudin and Flurbiprofen. Rheumatoid arthritis [FA20] [6]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Lepirudin and Fenoprofen. Rheumatoid arthritis [FA20] [6]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Lepirudin and Indomethacin. Rheumatoid arthritis [FA20] [6]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Lepirudin and Tolmetin. Rheumatoid arthritis [FA20] [6]
Salicyclic acid DM2F8XZ Moderate Increased risk of bleeding by the combination of Lepirudin and Salicyclic acid. Seborrhoeic dermatitis [EA81] [29]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Lepirudin and Curcumin. Solid tumour/cancer [2A00-2F9Z] [32]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Lepirudin and Warfarin. Supraventricular tachyarrhythmia [BC81] [11]
Anagrelide DMSQ8MD Major Increased risk of bleeding by the combination of Lepirudin and Anagrelide. Thrombocytosis [3B63] [6]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Lepirudin and Apixaban. Thrombosis [DB61-GB90] [12]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Lepirudin and Cangrelor. Thrombosis [DB61-GB90] [33]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Lepirudin and Brilinta. Thrombosis [DB61-GB90] [12]
Dicumarol DMFQCB1 Major Increased risk of bleeding by the combination of Lepirudin and Dicumarol. Thrombosis [DB61-GB90] [11]
Clopidogrel DMOL54H Major Increased risk of bleeding by the combination of Lepirudin and Clopidogrel. Thrombosis [DB61-GB90] [6]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Lepirudin and Cabozantinib. Thyroid cancer [2D10] [34]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Lepirudin and Betrixaban. Venous thromboembolism [BD72] [33]
⏷ Show the Full List of 94 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6469).
2 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3 Recombinant hirudin (lepirudin) as anticoagulant in intensive care patients treated with continuous hemodialysis. Kidney Int Suppl. 1999 Nov;(72):S46-50.
4 Product Information. Angiomax (bivalirudin) The Medicines Compny, Cambridge, MA.
5 Cerner Multum, Inc. "Australian Product Information.".
6 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
7 Booth SL, Golly I, Sacheck JM, Roubenoff R, Dallal GE, et al "Effect of vitamin E supplementation on vitamin K status in adults with normal coagulation status." Am J Clin Nutr 80 (2004): 143-8. [PMID: 15213041]
8 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
9 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
10 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
11 Bates ER, Mukherjee D, Lau WC "Drug-drug interactions involving antiplatelet agents." Eur Heart J 24 (2003): 1707-9. [PMID: 14522564]
12 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
13 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
14 Product Information. Fragmin (dalteparin). Pharmacia and Upjohn, Kalamazoo, MI.
15 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
16 Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
17 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
18 Canadian Pharmacists Association.
19 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
20 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
21 Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
22 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
23 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
24 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
25 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
26 Product Information. Refludan (lepirudin). Hoechst Marion-Roussel Inc, Kansas City, MO.
27 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
28 Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
29 Fausa O "Salicylate-induced hypoprothrombinemia: a report of four cases." Acta Med Scand 188 (1970): 403-8. [PMID: 5490567]
30 Product Information. Flolan (epoprostenol). Glaxo Wellcome, Research Triangle Park, NC.
31 Richards JR, Garber D, Laurin EG, et al. Treatment of cocaine cardiovascular toxicity: a systematic review.?Clin Toxicol (Phila). 2016;54(5):345-364. [PMID: 26919414]
32 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
33 Bodiford AB, Kessler FO, Fermo JD, Ragucci KR "Elevated international normalized ratio with the consumption of grapefruit and use of warfarin." SAGE Open Med Case Rep 0 (2013): 1-3. [PMID: 27489634]
34 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.