Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEB30C5)

DME Name	Carboxylesterase 1 (CES1)
Synonyms	Liver carboxylesterase 1; Methylumbelliferyl-acetate deacetylase 1; Monocyte/macrophage serine esterase; Acyl-coenzyme A:cholesterol acyltransferase; Brain carboxylesterase hBr1; Cocaine carboxylesterase; Egasyn; Retinyl ester hydrolase; Serine esterase 1; TGH; Triacylglycerol hydrolase; hCE-1; ACAT; CE-1; CES1; HMSE; REH; SES1
Gene Name	CES1
UniProt ID	EST1_HUMAN
INTEDE ID	DME0054
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	1066
EC Number	EC: 3.1.1.1 Hydrolases Ester bond hydrolase Carboxylic ester hydrolase EC: 3.1.1.1
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK DKEVAFWTNLFAKKAVEKPPQTEHIEL
Function	This enzyme is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. It hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. It also hydrolyzes the methyl ester group of cocaine to form benzoylecgonine and catalyzes the transesterification of cocaine to form cocaethylene.
KEGG Pathway	Drug metabolism - other enzymes (hsa00983 )
Reactome Pathway	Phase I - Functionalization of compounds (R-HSA-211945 ) Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

9 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Candesartan	DMRK8OT	Chronic heart failure	BD1Z	Approved	[40]
Dexmethylphenidate	DMUQE2A	Attention deficit hyperactivity disorder	6A05.Z	Approved	[41]
Enalapril	DMNFUZR	Congestive heart failure	BD10	Approved	[42]
Fenofibrate	DMFKXDY	Coronary atherosclerosis		Approved	[]
Irinotecan	DMP6SC2	Adenocarcinoma	2D40	Approved	[43]
Methylphenidate	DM7SJD6	Attention deficit hyperactivity disorder	6A05.Z	Approved	[44]
PSI-7977	DMLSUWZ	HCV 1-6 infection	1E51	Approved	[45]
Rufinamide	DMWE60C	Epilepsy	8A60-8A68	Approved	[46]
Salbutamol	DMN9CWF	Acute asthma	CA23	Approved	[47]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Approved Drug(s)

5 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dabigatran etexilate	DMRDZ4X	Venous thromboembolism	BD72	Phase 3	[48]
MK-4827	DMLYGH4	Ovarian cancer	2C73	Phase 3	[49]
Pradaxa	DM2ZYX9	Stroke	8B20	Phase 3	[50]
TA-6366	DMR32KN	N. A.	N. A.	Phase 3	[51]
E6005	DM1S489	Atopic dermatitis	EA80	Phase 2	[52]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nitrophenyl acetate	DMHSD8A	N. A.	N. A.	Investigative	[53]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	9.70E-25	-2.15E+00	-2.33E+00
Alopecia	ED70	Skin from scalp	4.17E-02	2.60E-01	3.47E-01
Alzheimer's disease	8A20	Entorhinal cortex	2.02E-01	-7.66E-03	-1.88E-02
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.08E-01	-2.81E-01	-2.74E-01
Aortic stenosis	BB70	Calcified aortic valve	9.22E-01	1.84E-01	9.78E-02
Apnea	7A40	Hyperplastic tonsil	9.46E-01	2.04E-02	4.14E-02
Arthropathy	FA00-FA5Z	Peripheral blood	8.31E-02	4.89E-01	7.60E-01
Asthma	CA23	Nasal and bronchial airway	3.93E-02	-9.53E-02	-1.15E-01
Atopic dermatitis	EA80	Skin	4.38E-03	-9.73E-01	-1.19E+00
Autism	6A02	Whole blood	2.24E-04	6.23E-01	8.32E-01
Autoimmune uveitis	9A96	Peripheral monocyte	1.72E-01	-1.80E+00	-1.19E+00
Autosomal dominant monocytopenia	4B04	Whole blood	2.20E-01	-1.12E-01	-3.63E-01
Bacterial infection of gingival	1C1H	Gingival tissue	5.84E-02	1.42E-01	3.34E-01
Batten disease	5C56.1	Whole blood	4.55E-01	4.83E-01	4.86E-01
Behcet's disease	4A62	Peripheral blood	1.15E-01	6.08E-01	8.43E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	4.48E-01	3.75E-02	1.64E-01
Bladder cancer	2C94	Bladder tissue	5.44E-05	-2.61E+00	-3.81E+00
Breast cancer	2C60-2C6Z	Breast tissue	1.06E-82	-3.27E+00	-1.91E+00
Cardioembolic stroke	8B11.20	Whole blood	5.90E-01	-3.78E-01	-3.64E-01
Cervical cancer	2C77	Cervical tissue	6.50E-01	-1.95E-01	-4.80E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	2.16E-01	8.81E-01	7.96E-01
Chronic hepatitis C	1E51.1	Whole blood	3.53E-02	5.59E-01	1.01E+00
Chronic obstructive pulmonary disease	CA22	Lung tissue	6.44E-02	-5.34E-02	-1.56E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.03E-02	1.57E-01	2.30E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	2.95E-02	-2.42E+00	-1.93E+00
Colon cancer	2B90	Colon tissue	4.43E-02	-2.91E-01	-4.35E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	8.00E-01	-1.66E-01	-1.64E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	9.37E-01	7.80E-02	2.35E-01
Endometriosis	GA10	Endometrium tissue	5.01E-02	7.32E-01	9.65E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.13E-01	-2.50E-02	-6.37E-02
Familial hypercholesterolemia	5C80.00	Whole blood	3.82E-08	1.86E+00	1.90E+00
Gastric cancer	2B72	Gastric tissue	7.92E-01	1.11E+00	5.41E-01
Glioblastopma	2A00.00	Nervous tissue	1.36E-05	1.11E-02	2.24E-02
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	2.75E-01	-1.33E+00	-1.74E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	1.77E-02	4.25E-01	5.41E-01
Head and neck cancer	2D42	Head and neck tissue	4.30E-23	-4.17E+00	-1.73E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	7.55E-01	8.84E-04	7.03E-03
Huntington's disease	8A01.10	Whole blood	8.88E-01	1.31E-01	1.31E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	5.79E-02	5.18E-01	1.36E+00
Immunodeficiency	4A00-4A20	Peripheral blood	2.61E-01	-1.14E-01	-6.25E-01
Influenza	1E30	Whole blood	4.79E-01	-1.27E+00	-1.02E+00
Interstitial cystitis	GC00.3	Bladder tissue	8.12E-02	-9.08E-01	-1.25E+00
Intracranial aneurysm	8B01.0	Intracranial artery	1.71E-01	-1.27E+00	-1.05E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	2.80E-02	-2.25E-01	-3.90E-01
Ischemic stroke	8B11	Peripheral blood	3.94E-01	-1.51E-01	-2.55E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.95E-02	-3.13E-01	-3.26E-01
Lateral sclerosis	8B60.4	Skin	4.08E-01	2.59E-01	5.39E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	9.97E-01	1.32E-02	6.46E-02
Liver cancer	2C12.0	Liver tissue	7.24E-13	-4.44E-01	-8.91E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.52E-02	-2.75E+00	-6.63E+00
Lung cancer	2C25	Lung tissue	1.32E-132	-2.41E+00	-3.96E+00
Lupus erythematosus	4A40	Whole blood	5.29E-04	6.65E-01	6.09E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	1.24E-01	1.06E-01	4.92E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.66E-02	4.85E-01	6.15E-01
Melanoma	2C30	Skin	1.30E-01	-7.08E-01	-4.18E-01
Multiple myeloma	2A83.1	Peripheral blood	8.75E-01	-7.38E-02	-1.99E-01
Multiple myeloma	2A83.1	Bone marrow	5.62E-01	5.91E-02	2.46E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	2.69E-03	4.17E-01	1.43E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	3.35E-01	-9.12E-02	-2.86E-01
Myelofibrosis	2A20.2	Whole blood	7.04E-01	-1.77E-01	-4.42E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.31E-02	3.95E-01	3.75E-01
Myopathy	8C70.6	Muscle tissue	4.09E-01	-2.10E-04	-8.23E-04
Neonatal sepsis	KA60	Whole blood	2.47E-12	8.60E-01	1.12E+00
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.06E-01	-6.91E-01	-1.19E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	2.05E-02	5.75E-01	1.68E+00
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.86E-01	1.95E-01	3.92E-01
Olive pollen allergy	CA08.00	Peripheral blood	6.44E-01	6.57E-01	5.59E-01
Oral cancer	2B6E	Oral tissue	6.07E-01	-5.61E-01	-4.35E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	9.83E-01	2.01E-02	3.15E-02
Osteoporosis	FB83.1	Bone marrow	1.29E-01	1.01E+00	7.49E-01
Ovarian cancer	2C73	Ovarian tissue	9.67E-03	-1.06E+00	-1.01E+00
Pancreatic cancer	2C10	Pancreas	3.15E-01	8.56E-01	6.63E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	7.50E-01	1.51E-02	4.41E-02
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	9.16E-06	1.13E+00	1.49E+00
Pituitary cancer	2D12	Pituitary tissue	5.99E-03	-6.26E-01	-1.04E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.04E-03	-1.10E+00	-1.60E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	8.41E-01	1.29E-01	3.14E-01
Polycythemia vera	2A20.4	Whole blood	2.76E-02	-1.70E-01	-4.18E-01
Pompe disease	5C51.3	Biceps muscle	9.15E-03	-1.36E+00	-2.16E+00
Preterm birth	KA21.4Z	Myometrium	7.25E-01	-3.88E-01	-4.13E-01
Prostate cancer	2C82	Prostate	1.36E-02	-6.80E-01	-5.59E-01
Psoriasis	EA90	Skin	1.16E-20	-1.29E+00	-1.59E+00
Rectal cancer	2B92	Rectal colon tissue	3.50E-01	-5.89E-01	-1.35E+00
Renal cancer	2C90-2C91	Kidney	7.08E-01	-2.01E-01	-3.61E-01
Retinoblastoma	2D02.2	Uvea	6.84E-01	-2.85E-01	-3.56E-01
Rheumatoid arthritis	FA20	Synovial tissue	4.14E-01	-1.61E-01	-2.07E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	3.13E-01	-2.99E-01	-2.62E-01
Schizophrenia	6A20	Prefrontal cortex	9.19E-02	1.89E-01	1.26E-01
Schizophrenia	6A20	Superior temporal cortex	4.40E-01	-8.76E-03	-6.81E-02
Scleroderma	4A42.Z	Whole blood	2.67E-03	1.22E+00	1.64E+00
Seizure	8A60-8A6Z	Whole blood	7.61E-01	-1.35E-01	-1.37E-01
Sensitive skin	EK0Z	Skin	5.32E-02	-5.67E-01	-1.68E+00
Sepsis with septic shock	1G41	Whole blood	3.00E-03	1.52E-01	1.93E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	1.42E-02	-9.55E-01	-3.49E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	6.24E-01	-4.91E-02	-3.31E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.76E-01	1.26E-01	6.52E-02
Sjogren's syndrome	4A43.2	Salivary gland tissue	2.06E-01	-1.22E+00	-1.07E+00
Skin cancer	2C30-2C3Z	Skin	5.51E-104	-2.80E+00	-2.86E+00
Thrombocythemia	3B63	Whole blood	2.37E-01	-5.68E-02	-1.46E-01
Thrombocytopenia	3B64	Whole blood	8.04E-01	2.52E-01	2.17E-01
Thyroid cancer	2D10	Thyroid	2.63E-12	-1.07E+00	-1.09E+00
Tibial muscular dystrophy	8C75	Muscle tissue	9.42E-04	-6.47E-01	-1.32E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.92E-01	1.59E-01	4.36E-01
Type 2 diabetes	5A11	Liver tissue	8.73E-01	1.89E-01	5.56E-01
Ureter cancer	2C92	Urothelium	4.91E-01	4.05E-02	1.70E-01
Uterine cancer	2C78	Endometrium tissue	2.69E-09	-1.21E+00	-1.17E+00
Vitiligo	ED63.0	Skin	8.73E-02	-2.23E-01	-3.29E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Liver carboxylesterase (CES1) DTT Info

DME DTT Type

Successful

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cholic Acid	DM7OKQV	Cholelithiasis	DC11	Approved	[1]
------------------------------------------------------------------------------------

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PACTIMIBE	DM0NZDT	Arteriosclerosis	BD40	Phase 2/3	[2]
Eldacimibe	DML7WP0	Hyperlipidaemia	5C80	Phase 2	[3]
K-604	DMQVN6P	Arteriosclerosis	BD40	Phase 2	[4]
GR148672X	DM7W6YN	Acute lymphoblastic leukaemia	2A85	Clinical trial	[5]
------------------------------------------------------------------------------------

21 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Avasimibe	DMFG4OM	Peripheral vascular disease	BD4Z	Discontinued in Phase 3	[6]
CI-976	DMBO28J	Hyperlipidaemia	5C80	Discontinued in Phase 2	[7]
CL-283796	DM7LIDT	Hyperlipidaemia	5C80	Discontinued in Phase 2	[8]
E-5324	DM562BM	Hyperlipidaemia	5C80	Discontinued in Phase 2	[9]
Eflucimibe	DMZXRF2	Hyperlipidaemia	5C80	Discontinued in Phase 2	[3]
RP-64477	DMTQ3BS	Hyperlipidaemia	5C80	Discontinued in Phase 2	[10]
447C88	DMC7M3K	Hyperlipidaemia	5C80	Discontinued in Phase 1	[11]
CL-277082	DMSB7WV	Arteriosclerosis	BD40	Discontinued in Phase 1	[12]
F-1394	DMPC9K3	Arteriosclerosis	BD40	Discontinued in Phase 1	[13]
YM-17E	DM0FSA9	Hyperlipidaemia	5C80	Discontinued in Phase 1	[14]
YM-750	DMLD2R0	Hyperlipidaemia	5C80	Discontinued in Phase 1	[15]
CEB-925	DMNJXRG	Hypercholesterolaemia	5C80.0	Terminated	[17]
CI-999	DMV1J0P	Arteriosclerosis	BD40	Terminated	[18]
DuP-129	DMJGCYO	Hypercholesterolaemia	5C80.0	Terminated	[5]
FR-129169	DM9V6AU	Arteriosclerosis	BD40	Terminated	[19]
FR-145237	DMHV43M	Arteriosclerosis	BD40	Terminated	[20]
Lecimibide	DMFEMTG	Hyperlipidaemia	5C80	Terminated	[21]
NTE-122	DMU3D1K	Arteriosclerosis	BD40	Terminated	[22]
RP-70676	DMHO5AG	Hyperlipidaemia	5C80	Terminated	[23]
RP-73163	DMO3FYI	Arteriosclerosis	BD40	Terminated	[24]
TEI-6522	DMHS5DX	Arteriosclerosis	BD40	Terminated	[25]
------------------------------------------------------------------------------------


⏷ Show the Full List of 21 Discontinued Drug(s)

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HL-004	DMRE52S	Arteriosclerosis	BD40	Preclinical	[16]
------------------------------------------------------------------------------------

113 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(1r)-1,2,2-trimethylpropyl (r)-methylphosphinate	DMVE34H	Discovery agent	N.A.	Investigative	[26]
(E)-Octadec-9-enoic acid phenylamide	DMP7TK0	Discovery agent	N.A.	Investigative	[27]
1,1,1-trifluoro-3-(hexylsulfinyl)propan-2-one	DMJ0ZMT	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluoro-3-(hexylsulfonyl)propan-2-one	DMWDUCH	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluoro-3-(hexylthio)propan-2-one	DMWGSP6	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluoro-3-(octylsulfinyl)propan-2-one	DMLBT0E	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluoro-3-(octylsulfonyl)propan-2-one	DMT29SN	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluoro-3-(octylthio)propan-2-one	DMU4EJW	Discovery agent	N.A.	Investigative	[28]
1,1,1-trifluorododecan-2-one	DMW6CQV	Discovery agent	N.A.	Investigative	[28]
1,10-phenanthroline-5,6-dione	DM5LVD2	Discovery agent	N.A.	Investigative	[29]
1,2-bis(2,3,4-trifluorophenyl)-2-hydroxyethanone	DMZSL7H	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3,4-trifluorophenyl)ethane-1,2-dione	DML5ECR	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3,5-trifluorophenyl)-2-hydroxyethanone	DMD9HP8	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3,5-trifluorophenyl)ethane-1,2-dione	DMZHWAV	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3,6-trifluorophenyl)ethane-1,2-dione	DMWS2HL	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3-difluorophenyl)-2-hydroxyethanone	DMZ0D5W	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,3-fluorophenyl)ethane-1,2-dione	DM9Z1NY	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,4-difluorophenyl)-2-hydroxyethanone	DMLMCBW	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,4-difluorophenyl)ethane-1,2-dione	DMUZHPS	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,5-difluorophenyl)-2-hydroxyethanone	DM9EW2F	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,5-difluorophenyl)ethane-1,2-dione	DMVLMBQ	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,6-difluorophenyl)-2-hydroxyethanone	DMSMVCH	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2,6-difluorophenyl)ethane-1,2-dione	DM351EA	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2-fluorophenyl)-2-hydroxyethanone	DMNWM5S	Discovery agent	N.A.	Investigative	[30]
1,2-bis(2-fluorophenyl)ethane-1,2-dione	DM9FMUE	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,4,5-trifluorophenyl)-2-hydroxyethanone	DM0LWAV	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,4,5-trifluorophenyl)ethane-1,2-dione	DMPJT3V	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,4-difluorophenyl)-2-hydroxyethanone	DMRCUKJ	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,4-difluorophenyl)ethane-1,2-dione	DMBZ5RN	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,5-difluorophenyl)-2-hydroxyethanone	DMQTPX2	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3,5-difluorophenyl)ethane-1,2-dione	DM3K5RI	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3-fluorophenyl)-2-hydroxyethanon	DM8XGD0	Discovery agent	N.A.	Investigative	[30]
1,2-bis(3-fluorophenyl)ethane-1,2-dione	DMM3I1P	Discovery agent	N.A.	Investigative	[30]
1,2-bis(4-fluorophenyl)ethane-1,2-dione	DM38Q7W	Discovery agent	N.A.	Investigative	[30]
1,2-Bis-(2-chloro-phenyl)-ethane-1,2-dione	DMZF4IC	Discovery agent	N.A.	Investigative	[31]
1,2-Bis-(3-methoxy-phenyl)-ethane-1,2-dione	DMWY1QN	Discovery agent	N.A.	Investigative	[31]
1,2-Bis-(3-nitro-phenyl)-ethane-1,2-dione	DMGSTKZ	Discovery agent	N.A.	Investigative	[31]
1,2-Bis-(4-bromo-phenyl)-ethane-1,2-dione	DMUW2EJ	Discovery agent	N.A.	Investigative	[31]
1,2-Bis-(4-chloro-phenyl)-ethane-1,2-dione	DM0E5FH	Discovery agent	N.A.	Investigative	[31]
1,2-Bis-(4-methoxy-phenyl)-ethane-1,2-dione	DMCGRV7	Discovery agent	N.A.	Investigative	[31]
1,2-Di-naphthalen-2-yl-ethane-1,2-dione	DMGXMF0	Discovery agent	N.A.	Investigative	[32]
1,2-Di-p-tolyl-ethane-1,2-dione	DMFXB21	Discovery agent	N.A.	Investigative	[31]
1,2-dicyclohexylethane-1,2-dione	DM75OR8	Discovery agent	N.A.	Investigative	[29]
1,2-indanedione	DMV275G	Discovery agent	N.A.	Investigative	[29]
1,2-NAPHTHOQUINONE	DMYXELH	Discovery agent	N.A.	Investigative	[29]
1-(2-bromoethyl)-1H-indole-2,3-dione	DMYF8ES	Discovery agent	N.A.	Investigative	[33]
1-(2-iodoethyl)-1H-indole-2,3-dione	DM1MSAC	Discovery agent	N.A.	Investigative	[33]
1-(3,4-dichlorobenzyl)-1H-indole-2,3-dione	DMX71K9	Discovery agent	N.A.	Investigative	[33]
1-(3,4-Dimethyl-phenyl)-2-phenyl-ethane-1,2-dione	DMCHILK	Discovery agent	N.A.	Investigative	[31]
1-(4-Chloro-phenyl)-2-p-tolyl-ethane-1,2-dione	DMOGVZ2	Discovery agent	N.A.	Investigative	[31]
1-(4-Chloro-phenyl)-2-phenyl-ethane-1,2-dione	DMCDV1O	Discovery agent	N.A.	Investigative	[31]
1-(4-chlorobenzyl)-1H-indole-2,3-dione	DMOUPNT	Discovery agent	N.A.	Investigative	[33]
1-(4-Methoxy-phenyl)-2-phenyl-ethane-1,2-dione	DM5R8KU	Discovery agent	N.A.	Investigative	[31]
1-(4-Nitro-phenyl)-2-phenyl-ethane-1,2-dione	DMOC67J	Discovery agent	N.A.	Investigative	[31]
1-benzyl-1H-indole-2,3-dione	DM2UFXE	Discovery agent	N.A.	Investigative	[33]
1-butyryl-1H-indole-2,3-dione	DMVFCLO	Discovery agent	N.A.	Investigative	[33]
1-dodecyl-1H-indole-2,3-dione	DMK6BWV	Discovery agent	N.A.	Investigative	[33]
1-hexadecyl-1H-indole-2,3-dione	DM4OWM6	Discovery agent	N.A.	Investigative	[33]
1-methyl-1H-indole-2,3-dione	DMPW75L	Discovery agent	N.A.	Investigative	[33]
1-phenyl-1H-indole-2,3-dione	DM74RMP	Discovery agent	N.A.	Investigative	[33]
1-Phenyl-2-p-tolyl-ethane-1,2-dione	DMW9CRT	Discovery agent	N.A.	Investigative	[31]
1-Phenyl-propane-1,2-dione	DM04SWY	Discovery agent	N.A.	Investigative	[31]
1-propionyl-1H-indole-2,3-dione	DM1TNWG	Discovery agent	N.A.	Investigative	[33]
11,12-dihydro-dibenzo[a,e]cyclooctene-5,6-dione	DME0OGM	Discovery agent	N.A.	Investigative	[29]
2,2-Dimethoxy-1,2-diphenyl-ethanone	DM34IX5	Discovery agent	N.A.	Investigative	[31]
2,2-dimethyl-3-methyleneheptadecane	DM7BL04	Discovery agent	N.A.	Investigative	[28]
2-methoxy-3,4-methylenedioxybenzophenone	DM93DYT	Discovery agent	N.A.	Investigative	[34]
3,4,5,6-Tetrachloro-[1,2]benzoquinone	DMSV6K5	Discovery agent	N.A.	Investigative	[31]
3,5-Di-tert-butyl-[1,2]benzoquinone	DMWOB7Q	Discovery agent	N.A.	Investigative	[31]
3-(butylsulfinyl)-1,1,1-trifluoropropan-2-one	DM8PM0E	Discovery agent	N.A.	Investigative	[28]
3-(butylthio)-1,1,1-trifluoropropan-2-one	DM8T2OX	Discovery agent	N.A.	Investigative	[28]
3-(decylsulfinyl)-1,1,1-trifluoropropan-2-one	DMWJ6UD	Discovery agent	N.A.	Investigative	[28]
3-(decylsulfonyl)-1,1,1-trifluoropropan-2-one	DMF27YT	Discovery agent	N.A.	Investigative	[28]
3-(decylthio)-1,1,1-trifluoropropan-2-one	DM1Y6L8	Discovery agent	N.A.	Investigative	[28]
3-(dodecylsulfinyl)-1,1,1-trifluoropropan-2-one	DM7AG6Y	Discovery agent	N.A.	Investigative	[28]
3-(dodecylsulfonyl)-1,1,1-trifluoropropan-2-one	DMPRCS0	Discovery agent	N.A.	Investigative	[28]
4,5-dichloro-1H-indole-2,3-dione	DMX94EK	Discovery agent	N.A.	Investigative	[33]
4,6-dichloro-1H-indole-2,3-dione	DMHBO17	Discovery agent	N.A.	Investigative	[33]
4,7-dichloro-1H-indole-2,3-dione	DMEVK5F	Discovery agent	N.A.	Investigative	[33]
4-(2-Oxo-2-phenyl-acetyl)-benzoic acid	DMFPNQ9	Discovery agent	N.A.	Investigative	[31]
4-chloro-1H-indole-2,3-dione	DM9HXPR	Discovery agent	N.A.	Investigative	[33]
4-chloro-7-methyl-1H-indole-2,3-dione	DM16P3N	Discovery agent	N.A.	Investigative	[33]
4-Piperidino-Piperidine	DMONGDX	Discovery agent	N.A.	Investigative	[26]
5,6-dinitroacenaphthoquinone	DM07HYA	Discovery agent	N.A.	Investigative	[29]
5,7-dichloro-1H-indole-2,3-dione	DMFHDWG	Discovery agent	N.A.	Investigative	[33]
5-(trifluoromethoxy)-1H-indole-2,3-dione	DMK3TEV	Discovery agent	N.A.	Investigative	[33]
5-chloro-1H-indole-2,3-dione	DMQ350F	Discovery agent	N.A.	Investigative	[33]
6,7-dichloro-1H-indole-2,3-dione	DMZHDFM	Discovery agent	N.A.	Investigative	[33]
6-bromo-5-methyl-1H-indole-2,3-dione	DMFZ2PI	Discovery agent	N.A.	Investigative	[33]
7-(trifluoromethyl)-1H-indole-2,3-dione	DM46VT2	Discovery agent	N.A.	Investigative	[33]
7-chloro-1H-indole-2,3-dione	DMCZLKA	Discovery agent	N.A.	Investigative	[33]
Acenanthrene-9,10-dione	DMU9O7K	Discovery agent	N.A.	Investigative	[29]
ACENAPHTHOQUINONE	DMU3DMH	Discovery agent	N.A.	Investigative	[29]
Alpha-D-Mannose	DMF5DLW	Discovery agent	N.A.	Investigative	[1]
BENZIL	DM5Y2M8	Discovery agent	N.A.	Investigative	[28]
Benzoin	DM50QMB	Discovery agent	N.A.	Investigative	[30]
CHLORANIL	DMCHGF1	Discovery agent	N.A.	Investigative	[31]
Dibutyl 2,2,2-trifluoro-1-phenylethyl phosphate	DM2G8ON	Discovery agent	N.A.	Investigative	[35]
Diethyl 2,2,2-trifluoro-1-phenylethyl phosphate	DMDJ9QA	Discovery agent	N.A.	Investigative	[35]
Dimethyl 2,2,2-trifluoro-1-phenylethyl phosphate	DMTVA49	Discovery agent	N.A.	Investigative	[35]
Heptane-2,3-dione	DMCFTB8	Discovery agent	N.A.	Investigative	[31]
KY-382	DMA9VBD	Arteriosclerosis	BD40	Investigative	[5]
N-Methylnaloxonium	DMXSJH0	Discovery agent	N.A.	Investigative	[36]
NSC-23180	DMJ91Y7	Discovery agent	N.A.	Investigative	[29]
O-Sialic Acid	DMCAR7B	Discovery agent	N.A.	Investigative	[26]
Oleic acid anilide	DMXCSVH	Discovery agent	N.A.	Investigative	[34]
Phenanthrene-9,10-dione	DMG8KS9	Discovery agent	N.A.	Investigative	[29]
PYRIPYROPENE A	DMCTJAM	Discovery agent	N.A.	Investigative	[27]
SCH-48375	DM0J937	Discovery agent	N.A.	Investigative	[37]
SMP-797	DMSI95J	Discovery agent	N.A.	Investigative	[38]
Thenoyltrifluoroacetone	DM54OKX	Discovery agent	N.A.	Investigative	[39]
Thieno[3,2-e][1]benzothiophene-4,5-dione	DMT74N6	Discovery agent	N.A.	Investigative	[29]
VULM-1457	DMWRX4T	Arteriosclerosis	BD40	Investigative	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 113 Investigative Drug(s)

References

1	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
2	Novel indoline-based acyl-CoA:cholesterol acyltransferase inhibitor with antiperoxidative activity: improvement of physicochemical properties and b... J Med Chem. 2008 Aug 14;51(15):4823-33.
3	Prospects for drug therapy for hyperlipoproteinaemia. Diabete Metab. 1995 Apr;21(2):139-46.
4	A selective ACAT-1 inhibitor, K-604, suppresses fatty streak lesions in fat-fed hamsters without affecting plasma cholesterol levels. Atherosclerosis. 2007 Apr;191(2):290-7.
5	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2592).
6	New advances in lipid-modifying therapies for reducing cardiovascular risk. Cardiology. 2002;97(2):59-66.
7	Acyl-coenzyme A:cholesterol-acyltransferase (ACAT) inhibitors modulate monocyte adhesion to aortic endothelial cells. Atherosclerosis. 1995 Jan 6;112(1):7-17.
8	ACAT inhibitors CL 283,546 and CL 283,796 reduce LDL cholesterol without affecting cholesterol absorption in African green monkeys. J Lipid Res. 1995 Jun;36(6):1199-210.
9	Effect of the acyl-CoA:cholesterol acyltransferase inhibitor, E5324, on experimental atherosclerosis in rabbits. Atherosclerosis. 1994 Jun;107(2):187-201.
10	RP 64477: a potent inhibitor of acyl-coenzyme A:cholesterol O-acyltransferase with low systemic bioavailability. Biochem Pharmacol. 1996 Feb 23;51(4):413-21.
11	The tolerability, pharmacokinetics and lack of effect on plasma cholesterol of 447C88, an AcylCoA: Cholesterol Acyl Transferase (ACAT) inhibitor with low bioavailability, in healthy volunteers. Eur JClin Pharmacol. 1995;49(3):243-9.
12	CL 277,082: a novel inhibitor of ACAT-catalyzed cholesterol esterification and cholesterol absorption. J Lipid Res. 1989 May;30(5):681-90.
13	ACAT inhibitor F-1394 prevents intimal hyperplasia induced by balloon injury in rabbits. J Lipid Res. 2001 Apr;42(4):480-8.
14	Pharmacological properties of YM17E, an acyl-CoA:cholesterol acyltransferase inhibitor, and diarrheal effect in beagle dogs. Jpn J Pharmacol. 1997 Jan;73(1):41-50.
15	Effects of an anti-oxidative ACAT inhibitor on apoptosis/necrosis and cholesterol accumulation under oxidative stress in THP-1 cell-derived foam ce... Life Sci. 2008 Jan 2;82(1-2):79-84.
16	ACAT inhibitor HL-004 accelerates the regression of hypercholesterolemia in stroke-prone spontaneously hypertensive rats (SHRSP): stimulation of bile acid production by HL-004. Atherosclerosis. 1997 Aug;133(1):97-104.
17	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010079)
18	Inhibitors of acyl-CoA:cholesterol O-acyltransferase (ACAT) as hypocholesterolemic agents: synthesis and structure-activity relationships of novel series of sulfonamides, acylphosphonamides and acylphosphoramidates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):289-94.
19	Plasma cholesterol reducing effect of FR129169, a novel acyl-CoA:cholesterol acyltransferase inhibitor, in the rat. Jpn J Pharmacol. 1996 Jan;70(1):35-41.
20	Effect of FR145237, a novel ACAT inhibitor, on atherogenesis in cholesterol-fed and WHHL rabbits. Evidence for a direct effect on the arterial wall. Biochim Biophys Acta. 1995 Dec 7;1259(3):254-60.
21	Effect of the acyl-CoA:cholesterol acyltransferase inhibitor DuP 128 on cholesterol absorption and serum cholesterol in humans. Clin Pharmacol Ther. 1994 Jul;56(1):65-74.
22	Cholesterol-lowering effects of NTE-122, a novel acyl-CoA:cholesterol acyltransferase (ACAT) inhibitor, on cholesterol diet-fed rats and rabbits. Jpn J Pharmacol. 1998 Nov;78(3):355-64.
23	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002876)
24	Hypolipidaemic properties of a potent and bioavailable alkylsulphinyl-diphenylimidazole ACAT inhibitor (RP 73163) in animals fed diets low in cholesterol. Biochem Pharmacol. 1996 Oct 25;52(8):1177-86.
25	Potent inhibitors of acyl-CoA:cholesterol acyltransferase. Structure-activity relationships of novel N-(4-oxochroman-8-yl)amides. J Med Chem. 1995 Aug 4;38(16):3174-86.
26	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
27	Acyl-CoA: cholesterol acyltransferase inhibitory activities of fatty acid amides isolated from Mylabris phalerate Pallas. Bioorg Med Chem Lett. 2004 Aug 16;14(16):4277-80.
28	Influence of sulfur oxidation state and steric bulk upon trifluoromethyl ketone (TFK) binding kinetics to carboxylesterases and fatty acid amide hy... Bioorg Med Chem. 2008 Feb 15;16(4):2114-30.
29	Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. J Med Chem. 2007 Nov 15;50(23):5727-34.
30	Analysis of the inhibition of mammalian carboxylesterases by novel fluorobenzoins and fluorobenzils. Bioorg Med Chem. 2007 Jun 1;15(11):3801-17.
31	Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem. 2005 Apr 21;48(8):2906-15.
32	Inhibition of carboxylesterases by benzil (diphenylethane-1,2-dione) and heterocyclic analogues is dependent upon the aromaticity of the ring and t... J Med Chem. 2005 Aug 25;48(17):5543-50.
33	Selective inhibition of carboxylesterases by isatins, indole-2,3-diones. J Med Chem. 2007 Apr 19;50(8):1876-85.
34	Phenolic compounds from the roots of Lindera fruticosa. J Nat Prod. 2006 May;69(5):853-5.
35	Synthesis of organophosphates with fluorine-containing leaving groups as serine esterase inhibitors with potential for Alzheimer disease therapeutics. Bioorg Med Chem Lett. 2009 Oct 1;19(19):5528-30.
36	DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
37	2-Azetidinones as inhibitors of cholesterol absorption. J Med Chem. 1994 Jun 10;37(12):1733-6.
38	Company report (Dainippon Sumitomo Pharma)
39	Zhang JG, Fariss MW: Thenoyltrifluoroacetone, a potent inhibitor of carboxylesterase activity. Biochem Pharmacol. 2002 Feb 15;63(4):751-4.
40	Different hydrolases involved in bioactivation of prodrug-type angiotensin receptor blockers: carboxymethylenebutenolidase and carboxylesterase 1. Drug Metab Dispos. 2013 Nov;41(11):1888-95.
41	Dexmethylphenidate hydrochloride in the treatment of attention deficit hyperactivity disorder. Neuropsychiatr Dis Treat. 2006 Dec;2(4):467-73.
42	Absorption and cleavage of enalapril, a carboxyl ester prodrug, in the rat intestine: in vitro, in situ intestinal perfusion and portal vein cannulation models. Biopharm Drug Dispos. 2015 Sep;36(6):385-397.
43	Irinotecan and its active metabolite, SN-38: review of bioanalytical methods and recent update from clinical pharmacology perspectives. Biomed Chromatogr. 2010 Jan;24(1):104-23.
44	Methylphenidate is stereoselectively hydrolyzed by human carboxylesterase CES1A1. J Pharmacol Exp Ther. 2004 Aug;310(2):469-76.
45	Mechanism of activation of PSI-7851 and its diastereoisomer PSI-7977. J Biol Chem. 2010 Nov 5;285(45):34337-47.
46	Investigation of the metabolism of rufinamide and its interaction with valproate. Drug Metab Lett. 2011 Dec;5(4):280-9.
47	Effect of carboxylesterase 1 c.428G>A single nucleotide variation on the pharmacokinetics of quinapril and enalapril. Br J Clin Pharmacol. 2015 Nov;80(5):1131-8.
48	Pharmacogenomics of novel direct oral anticoagulants: newly identified genes and genetic variants. J Pers Med. 2019 Jan 17;9(1). pii: E7.
49	Summary of FDA-approved anticancer cytotoxic drugs at May 2019.
50	Conventional liquid chromatography/triple quadrupole mass spectrometry based metabolite identification and semi-quantitative estimation approach in the investigation of in vitro dabigatran etexilate metabolism. Anal Bioanal Chem. 2013 Feb;405(5):1695-704.
51	Inhibition of human liver carboxylesterase (hCE1) by organophosphate ester flame retardants and plasticizers: implications for pharmacotherapy. Toxicol Sci. 2019 Jul 3. pii: kfz149.
52	Safety and efficacy of topical E6005, a phosphodiesterase 4 inhibitor, in Japanese adult patients with atopic dermatitis: results of a randomized, vehicle-controlled, multicenter clinical trial. J Dermatol. 2014 Jul;41(7):577-85.
53	Characterization of pyrethroid hydrolysis by the human liver carboxylesterases hCE-1 and hCE-2. Arch Biochem Biophys. 2006 Jan 1;445(1):115-23.