Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYWLRK)

DME Name Sulfotransferase 1A1 (SULT1A1)
Synonyms
Sulfotransferase family cytosolic 1A member 1; Aryl sulfotransferase 1A1; Aryl sulfotransferase 1; Thermostable phenol sulfotransferase; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; Ts-PST; HAST1/HAST2; OK/SW-cl.88; P-PST 1; ST1A1; STP; STP1; SULT1A1
Gene Name SULT1A1
UniProt ID
ST1A1_HUMAN
INTEDE ID
DME0008
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6817
EC Number EC: 2.8.2.1
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Function
This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. It also has estrogen sulfotransferase activity and is responsible for the sulfonation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Reactome Pathway
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
24 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetaminophen DMUIE76 Allergic rhinitis CA08.0 Approved [1]
Adenosine DMM2NSK Paroxysmal supraventricular tachycardia BC81.Z Approved [2]
Apomorphine DMX38HQ Parkinson disease 8A00.0 Approved [3]
Aspirin DM672AH Acute coronary syndrome BA41 Approved [4]
Benzyl alcohol DMBVYDI Head and body lice 1G00.0 Approved [5]
Budesonide DMJIBAW Allergic rhinitis CA08.0 Approved [6]
Celecoxib DM6LOQU Dysmenorrhea GA34.3 Approved [7]
Cholic Acid DM7OKQV Cholelithiasis DC11 Approved [8]
Digitoxin DMWVIGP Arrhythmia BC9Z Approved [9]
Ephedrine DMMV0KW Allergic rhinitis CA08.0 Approved [10]
Epinephrine DM3KJBC Acute asthma CA23 Approved [11]
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [12]
Liothyronine DM6IR3P Congenital hypothyroidism Approved [13]
Methyldopa DM5I621 Hypertension BA00-BA04 Approved [14]
Minoxidil DMA2Z4F Alopecia ED70 Approved [15]
Pantoprazole DMSVOCZ Gastrinoma 2C10.1 Approved [16]
Progesterone DMUY35B Amenorrhea GA20.0 Approved [17]
Pseudoephedrine DMIVJ0D Allergic rhinitis CA08.0 Approved [10]
Ritodrine DM4V6RL Premature labour JB00 Approved [18]
Rotigotine DMP7X6Q N. A. N. A. Approved [19]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [20]
Teicoplanin DMAQ2LK Bacterial infection 1A00-1C4Z Approved [21]
Tibolone DM78XFG Anabolic metabolism 5C50-5C8Z Approved [22]
Warfarin DMJYCVW Atrial fibrillation BC81.3 Approved [23]
⏷ Show the Full List of 24 Approved Drug(s)
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CERC-801 DM3SZ7P N. A. N. A. Phase 2 [24]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CLIOQUINOL DM746BZ N. A. N. A. Withdrawn from market [25]
4 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aminobenzoic acid DMNGW2M N. A. N. A. Investigative [26]
Diiodo-l-thyronine DM917FE N. A. N. A. Investigative [13]
L-thyroxine DM83HWL N. A. N. A. Investigative [13]
Triiodo-l-thyronine DMVJD1A N. A. N. A. Investigative [13]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Benzyl alcohol Head and body lice [1G00.0] Approved Km = 0.0685 microM [5]
Liothyronine Congenital hypothyroidism [] Approved Km = 0.084 microM [13]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.68E-09 -5.32E-01 -8.75E-01
Alopecia ED70 Skin from scalp 3.88E-01 -5.34E-02 -1.38E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.47E-01 3.57E-02 1.73E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.49E-02 4.31E-01 1.22E+00
Aortic stenosis BB70 Calcified aortic valve 6.88E-01 3.80E-02 3.18E-02
Apnea 7A40 Hyperplastic tonsil 4.16E-01 2.24E-01 4.55E-01
Arthropathy FA00-FA5Z Peripheral blood 6.36E-01 1.20E-02 3.27E-02
Asthma CA23 Nasal and bronchial airway 2.85E-02 1.23E-01 1.51E-01
Atopic dermatitis EA80 Skin 9.94E-04 3.59E-01 2.58E+00
Autism 6A02 Whole blood 6.77E-01 -1.14E-01 -2.77E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.40E-01 -2.44E-02 -4.27E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.56E-02 -7.60E-01 -1.33E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.93E-08 3.74E-01 9.66E-01
Batten disease 5C56.1 Whole blood 1.36E-02 -7.37E-01 -4.41E+00
Behcet's disease 4A62 Peripheral blood 9.21E-01 1.16E-01 3.06E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.90E-01 -2.90E-02 -1.34E-01
Bladder cancer 2C94 Bladder tissue 1.30E-03 -4.62E-01 -1.61E+00
Breast cancer 2C60-2C6Z Breast tissue 1.86E-04 2.54E-01 5.19E-01
Cardioembolic stroke 8B11.20 Whole blood 4.53E-01 -1.33E-02 -3.86E-02
Cervical cancer 2C77 Cervical tissue 1.99E-01 2.42E-01 3.18E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.58E-01 1.21E-03 2.57E-03
Chronic hepatitis C 1E51.1 Whole blood 7.66E-01 -1.06E-01 -1.98E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.62E-02 -1.87E-01 -4.46E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.72E-01 6.81E-02 1.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.19E-01 9.00E-02 1.84E-01
Colon cancer 2B90 Colon tissue 3.08E-122 -1.86E+00 -4.11E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.80E-01 1.16E-01 3.20E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.24E-01 1.10E-01 1.58E-01
Endometriosis GA10 Endometrium tissue 2.58E-01 -3.40E-01 -4.65E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.06E-01 -1.41E-01 -4.50E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.61E-12 1.01E+00 1.51E+00
Gastric cancer 2B72 Gastric tissue 5.41E-01 -5.26E-01 -8.08E-01
Glioblastopma 2A00.00 Nervous tissue 4.66E-98 -6.77E-01 -1.73E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.92E-09 -7.60E-01 -9.59E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.12E-02 8.26E-01 9.43E-01
Head and neck cancer 2D42 Head and neck tissue 1.33E-13 -5.98E-01 -6.06E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.72E-01 2.42E-02 7.36E-02
Huntington's disease 8A01.10 Whole blood 7.58E-01 3.02E-02 1.04E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.10E-01 2.08E-01 5.26E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.34E-02 -1.61E-01 -8.65E-01
Influenza 1E30 Whole blood 4.30E-01 2.36E-01 5.81E-01
Interstitial cystitis GC00.3 Bladder tissue 8.76E-01 9.79E-02 2.74E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.66E-03 6.24E-01 1.39E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.00E-02 -5.31E-01 -8.17E-01
Ischemic stroke 8B11 Peripheral blood 8.20E-01 -1.78E-01 -3.50E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.74E-08 -6.09E-01 -9.05E-01
Lateral sclerosis 8B60.4 Skin 1.33E-02 1.73E-01 2.66E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.37E-01 -1.61E-01 -5.99E-01
Liver cancer 2C12.0 Liver tissue 1.59E-12 -1.21E+00 -1.58E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.18E-01 2.57E-01 4.12E-01
Lung cancer 2C25 Lung tissue 4.57E-88 -1.17E+00 -2.60E+00
Lupus erythematosus 4A40 Whole blood 1.16E-08 5.39E-01 6.44E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.72E-02 6.46E-02 2.89E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.30E-01 -4.93E-02 -6.94E-02
Melanoma 2C30 Skin 3.67E-01 -6.97E-01 -5.48E-01
Multiple myeloma 2A83.1 Peripheral blood 2.30E-01 1.89E-01 5.25E-01
Multiple myeloma 2A83.1 Bone marrow 1.21E-01 3.91E-01 7.16E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.22E-02 1.64E-01 5.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.07E-05 3.02E-01 8.70E-01
Myelofibrosis 2A20.2 Whole blood 1.69E-01 -2.25E-01 -5.39E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.62E-02 2.51E-01 3.65E-01
Myopathy 8C70.6 Muscle tissue 1.93E-04 4.88E-01 2.67E+00
Neonatal sepsis KA60 Whole blood 2.91E-07 4.72E-01 6.99E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.38E-07 -7.65E-01 -2.96E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.16E-02 -3.96E-01 -6.27E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.86E-01 -1.80E-01 -2.64E-01
Olive pollen allergy CA08.00 Peripheral blood 6.22E-01 1.02E-01 3.01E-01
Oral cancer 2B6E Oral tissue 5.33E-03 -4.99E-01 -7.60E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.74E-01 -5.26E-02 -2.14E-01
Osteoporosis FB83.1 Bone marrow 8.23E-01 6.63E-03 1.33E-02
Ovarian cancer 2C73 Ovarian tissue 5.19E-02 7.69E-02 1.83E-01
Pancreatic cancer 2C10 Pancreas 1.31E-02 7.29E-01 9.19E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.45E-01 1.10E-01 2.25E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.62E-03 4.42E-01 7.42E-01
Pituitary cancer 2D12 Pituitary tissue 1.38E-02 -3.57E-01 -7.63E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.08E-01 4.96E-02 1.45E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.13E-01 9.76E-02 6.56E-01
Polycythemia vera 2A20.4 Whole blood 7.62E-03 -1.11E-01 -2.49E-01
Pompe disease 5C51.3 Biceps muscle 4.01E-04 9.76E-01 1.57E+00
Preterm birth KA21.4Z Myometrium 4.49E-01 -4.54E-02 -9.42E-02
Prostate cancer 2C82 Prostate 3.87E-01 3.66E-01 4.21E-01
Psoriasis EA90 Skin 2.30E-01 -6.03E-02 -1.32E-01
Rectal cancer 2B92 Rectal colon tissue 7.87E-07 -1.63E+00 -5.54E+00
Renal cancer 2C90-2C91 Kidney 4.58E-02 -8.78E-02 -2.11E-01
Retinoblastoma 2D02.2 Uvea 8.18E-05 1.15E+00 5.93E+00
Rheumatoid arthritis FA20 Synovial tissue 2.36E-04 6.73E-01 3.00E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.97E-02 -1.15E-01 -3.70E-01
Schizophrenia 6A20 Prefrontal cortex 1.78E-01 1.06E-01 1.65E-01
Schizophrenia 6A20 Superior temporal cortex 5.69E-01 -3.98E-02 -1.90E-01
Scleroderma 4A42.Z Whole blood 1.94E-01 2.30E-01 4.10E-01
Seizure 8A60-8A6Z Whole blood 8.82E-01 -2.93E-02 -8.27E-02
Sensitive skin EK0Z Skin 8.48E-01 5.79E-02 3.07E-01
Sepsis with septic shock 1G41 Whole blood 1.37E-03 2.13E-01 3.00E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.60E-02 -5.24E-01 -1.40E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.92E-01 -3.10E-01 -7.59E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.76E-01 -2.82E-02 -2.35E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.95E-02 -2.25E-01 -1.69E+00
Skin cancer 2C30-2C3Z Skin 1.66E-02 -8.90E-02 -1.64E-01
Thrombocythemia 3B63 Whole blood 3.04E-01 1.91E-02 4.46E-02
Thrombocytopenia 3B64 Whole blood 3.67E-01 2.61E-01 2.10E-01
Thyroid cancer 2D10 Thyroid 1.82E-04 -1.89E-01 -4.65E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.41E-05 6.69E-01 1.57E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.62E-02 -5.50E-01 -3.85E+00
Type 2 diabetes 5A11 Liver tissue 9.67E-01 2.92E-01 5.33E-01
Ureter cancer 2C92 Urothelium 5.66E-02 1.05E-01 4.66E-01
Uterine cancer 2C78 Endometrium tissue 1.61E-03 -2.57E-01 -3.75E-01
Vitiligo ED63.0 Skin 7.75E-01 1.30E-02 3.91E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects. Birth Defects Res A Clin Mol Teratol. 2008 Mar;82(3):155-65.
2 Regulation of sulfate assimilation in plants: 7. Cysteine inactivation of adenosine 5'-phosphosulfate sulfotransferase in Lemna minor L. Plant Physiol. 1978 Mar;61(3):342-7.
3 Sulfation of apomorphine by human sulfotransferases: evidence of a major role for the polymorphic phenol sulfotransferase, SULT1A1. Xenobiotica. 2003 Nov;33(11):1139-48.
4 Inhibition of human phenol and estrogen sulfotransferase by certain non-steroidal anti-inflammatory agents. Curr Drug Metab. 2006 Oct;7(7):745-53.
5 Sulfation of benzyl alcohol by the human cytosolic sulfotransferases (SULTs): a systematic analysis. J Appl Toxicol. 2016 Sep;36(9):1090-4.
6 Sulfation of budesonide by human cytosolic sulfotransferase, dehydroepiandrosterone-sulfotransferase (DHEA-ST). Drug Metab Dispos. 2002 May;30(5):582-5.
7 Sulfonation of 17beta-estradiol and inhibition of sulfotransferase activity by polychlorobiphenylols and celecoxib in channel catfish, Ictalurus punctatus. Aquat Toxicol. 2007 Mar 10;81(3):286-92.
8 Kinetic analysis of bile acid sulfation by stably expressed human sulfotransferase 2A1 (SULT2A1). Xenobiotica. 2010 Mar;40(3):184-94.
9 Hydroxysteroid sulfotransferase and a specific UDP-glucuronosyltransferase are involved in the metabolism of digitoxin in man. Naunyn Schmiedebergs Arch Pharmacol. 1992 Aug;346(2):226-33.
10 Benzylic alcohols as stereospecific substrates and inhibitors for aryl sulfotransferase. Chirality. 1991;3(2):104-11.
11 Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate. Biochem Biophys Res Commun. 2005 Sep 23;335(2):417-23.
12 Proposed role of the sulfotransferase/sulfatase pathway in modulating yolk steroid effects. Integr Comp Biol. 2008 Sep;48(3):419-27.
13 Characterization of human liver thermostable phenol sulfotransferase (SULT1A1) allozymes with 3,3',5-triiodothyronine as the substrate. J Endocrinol. 2001 Dec;171(3):525-32.
14 Platelet phenol sulfotransferase and erythrocyte catechol-O-methyltransferase activities: correlation with methyldopa metabolism. Clin Pharmacol Ther. 1984 Jan;35(1):55-63.
15 Sulfation of minoxidil by multiple human cytosolic sulfotransferases. Chem Biol Interact. 1998 Feb 20;109(1-3):53-67.
16 Interaction of proton pump inhibitors with cytochromes P450: consequences for drug interactions. Yale J Biol Med. 1996 May-Jun;69(3):203-9.
17 Progestagenic effects of tibolone are target gene-specific in human endometrial cells. J Soc Gynecol Investig. 2006 Sep;13(6):459-65.
18 Inhibitory effects of various beverages on ritodrine sulfation by recombinant human sulfotransferase isoforms SULT1A1 and SULT1A3. Pharm Res. 2005 Aug;22(8):1406-10.
19 Identification of the human SULT enzymes involved in the metabolism of rotigotine. J Clin Pharmacol. 2016 Jun;56(6):754-60.
20 Tamoxifen-induced adduct formation and cell stress in human endometrial glands. Drug Metab Dispos. 2010 Jan;38(1):200-7.
21 The 2.7 A resolution structure of the glycopeptide sulfotransferase Teg14. Acta Crystallogr D Biol Crystallogr. 2010 Dec;66(Pt 12):1278-86.
22 Sulfation of tibolone metabolites by human postmenopausal liver and small intestinal sulfotransferases (SULTs). Steroids. 2006 May;71(5):343-51.
23 Natural products isolated from Mexican medicinal plants: novel inhibitors of sulfotransferases, SULT1A1 and SULT2A1. Phytomedicine. 2001 Nov;8(6):481-8.
24 Sulfation of the galactose residues in the glycosaminoglycan-protein linkage region by recombinant human chondroitin 6-O-sulfotransferase-1. J Biol Chem. 2008 Oct 10;283(41):27438-43.
25 Clioquinol is sulfated by human jejunum cytosol and SULT1A3, a human-specific dopamine sulfotransferase. Toxicol Lett. 2011 Oct 10;206(2):229-33.
26 Activities of drug metabolizing enzymes in bovine colon epithelial cell cultures. Arch Toxicol. 2003 Nov;77(11):621-9.