Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0J3CPT)

• DOT Name: Retinoid-binding protein 7 (RBP7)
• Synonyms: Cellular retinoic acid-binding protein 4; CRABP4; CRBP4; Cellular retinoic acid-binding protein IV; CRABP-IV
• Gene Name: RBP7
• Related Disease:
  Advanced cancer
  Colon cancer
  Colon carcinoma
  Nasopharyngeal carcinoma
  Neoplasm
  Neuroblastoma
  Asthma
• UniProt ID: RET7_HUMAN
• PDB ID: 1LPJ; 6AT8; 6E6K
• Pfam ID: PF00061
• Sequence:
  MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRN
  YFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEM
  FCEGQVCKQTFQRA
• Function: Intracellular transport of retinol.
• Tissue Specificity: Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Colon cancer	DISVC52G	Strong	Biomarker	[1]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[1]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[2]
Neoplasm	DISZKGEW	moderate	Biomarker	[2]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[3]
Asthma	DISW9QNS	Limited	Altered Expression	[4]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Retinoid-binding protein 7 (RBP7).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Retinoid-binding protein 7 (RBP7).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Retinoid-binding protein 7 (RBP7).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Retinoid-binding protein 7 (RBP7).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Retinoid-binding protein 7 (RBP7).	[9]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Retinoid-binding protein 7 (RBP7).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Retinoid-binding protein 7 (RBP7).	[3]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Retinoid-binding protein 7 (RBP7).	[12]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Retinoid-binding protein 7 (RBP7).	[13]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Retinoid-binding protein 7 (RBP7).	[15]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Retinoid-binding protein 7 (RBP7).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Retinoid-binding protein 7 (RBP7).	[16]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Retinoid-binding protein 7 (RBP7).	[17]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Retinoid-binding protein 7 (RBP7).	[14]

References

• [1] RBP7 is a clinically prognostic biomarker and linked to tumor invasion and EMT in colon cancer.J Cancer. 2019 Aug 27;10(20):4883-4891. doi: 10.7150/jca.35180. eCollection 2019.
• [2] Epigenetic silencing of cellular retinol-binding proteins in nasopharyngeal carcinoma.Neoplasia. 2005 Jan;7(1):67-74. doi: 10.1593/neo.04370.
• [3] Genetic and epigenetic changes in the common 1p36 deletion in neuroblastoma tumours. Br J Cancer. 2007 Nov 19;97(10):1416-24. doi: 10.1038/sj.bjc.6604032. Epub 2007 Oct 16.
• [4] Expression profiling of genes related to asthma exacerbations.Clin Exp Allergy. 2009 Feb;39(2):213-21. doi: 10.1111/j.1365-2222.2008.03186.x.
• [5] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Genetic and epigenetic changes in the common 1p36 deletion in neuroblastoma tumours. Br J Cancer. 2007 Nov 19;97(10):1416-24. doi: 10.1038/sj.bjc.6604032. Epub 2007 Oct 16.
• [12] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [13] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [17] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.