Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2H13BX)

DOT Name Natural cytotoxicity triggering receptor 2 (NCR2)
Synonyms Lymphocyte antigen 95 homolog; NK cell-activating receptor; Natural killer cell p44-related protein; NK-p44; NKp44; CD antigen CD336
Gene Name NCR2
Related Disease
Acute monocytic leukemia ( )
Advanced cancer ( )
B-cell lymphoma ( )
Breast cancer ( )
Breast carcinoma ( )
Crohn disease ( )
Hepatocellular carcinoma ( )
HIV infectious disease ( )
Juvenile idiopathic arthritis ( )
Neoplasm ( )
Obesity ( )
Plasma cell myeloma ( )
Systemic lupus erythematosus ( )
Influenza ( )
MALT lymphoma ( )
Periodontitis ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Ankylosing spondylitis ( )
Glioblastoma multiforme ( )
Pregnancy disorder ( )
UniProt ID
NCTR2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1HKF
Pfam ID
PF07686
Sequence
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASA
LVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS
KSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQN
STLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQ
VTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL
Function Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Tissue Specificity Selectively expressed by activated NK cells and by in vitro cultured (i.e. activated) TCRg/d lymphoid cells.
KEGG Pathway
.tural killer cell mediated cytotoxicity (hsa04650 )
Reactome Pathway
DAP12 interactions (R-HSA-2172127 )
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute monocytic leukemia DIS28NEL Strong Altered Expression [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
B-cell lymphoma DISIH1YQ Strong Altered Expression [3]
Breast cancer DIS7DPX1 Strong Altered Expression [4]
Breast carcinoma DIS2UE88 Strong Altered Expression [4]
Crohn disease DIS2C5Q8 Strong Altered Expression [5]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [6]
HIV infectious disease DISO97HC Strong Biomarker [7]
Juvenile idiopathic arthritis DISQZGBV Strong Altered Expression [8]
Neoplasm DISZKGEW Strong Altered Expression [9]
Obesity DIS47Y1K Strong Biomarker [10]
Plasma cell myeloma DIS0DFZ0 Strong Altered Expression [11]
Systemic lupus erythematosus DISI1SZ7 Strong Altered Expression [12]
Influenza DIS3PNU3 moderate Biomarker [13]
MALT lymphoma DIS1AVVE moderate Biomarker [14]
Periodontitis DISI9JOI moderate Biomarker [15]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [1]
Adult glioblastoma DISVP4LU Limited Altered Expression [16]
Ankylosing spondylitis DISRC6IR Limited Altered Expression [17]
Glioblastoma multiforme DISK8246 Limited Altered Expression [16]
Pregnancy disorder DIS5V7J6 Limited Genetic Variation [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Natural cytotoxicity triggering receptor 2 (NCR2). [19]
------------------------------------------------------------------------------------

References

1 Survival in acute myeloid leukemia is associated with NKp44 splice variants.Oncotarget. 2016 May 31;7(22):32933-45. doi: 10.18632/oncotarget.8782.
2 Regulation of NKG2D-Dependent NK Cell Functions: The Yin and the Yang of Receptor Endocytosis.Int J Mol Sci. 2017 Aug 2;18(8):1677. doi: 10.3390/ijms18081677.
3 Modulation the expression of natural killer cell activating receptor (NKp44) in the peripheral blood of diffuse large B-cell lymphoma patients and the correlation with clinic pathological features.Clin Immunol. 2018 Mar;188:38-44. doi: 10.1016/j.clim.2017.12.003. Epub 2017 Dec 13.
4 Altered expression of miR-181a and miR-146a does not change the expression of surface NCRs in human NK cells.Sci Rep. 2017 Feb 1;7:41381. doi: 10.1038/srep41381.
5 CD62L Is a Functional and Phenotypic Marker for Circulating Innate Lymphoid Cell Precursors.J Immunol. 2019 Jan 1;202(1):171-182. doi: 10.4049/jimmunol.1701153. Epub 2018 Nov 30.
6 MICA/B expression is inhibited by unfolded protein response and associated with poor prognosis in human hepatocellular carcinoma.J Exp Clin Cancer Res. 2014 Sep 18;33(1):76. doi: 10.1186/s13046-014-0076-7.
7 A novel ligand on astrocytes interacts with natural cytotoxicity receptor NKp44 regulating immune response mediated by NK cells.PLoS One. 2018 Feb 15;13(2):e0193008. doi: 10.1371/journal.pone.0193008. eCollection 2018.
8 Innate Lymphoid Cells and T Cells Contribute to the Interleukin-17A Signature Detected in the Synovial Fluid of Patients With Juvenile Idiopathic Arthritis.Arthritis Rheumatol. 2019 Mar;71(3):460-467. doi: 10.1002/art.40731. Epub 2019 Jan 28.
9 GMP-Compliant Manufacturing of NKG2D CAR Memory T Cells Using CliniMACS Prodigy.Front Immunol. 2019 Oct 10;10:2361. doi: 10.3389/fimmu.2019.02361. eCollection 2019.
10 Natural Killer Cells from the Subcutaneous Adipose Tissue Underexpress the NKp30 and NKp44 in Obese Persons and Are Less Active against Major Histocompatibility Complex Class I Non-Expressing Neoplastic Cells.Front Immunol. 2017 Nov 7;8:1486. doi: 10.3389/fimmu.2017.01486. eCollection 2017.
11 Differential expression of natural killer cell activating receptors in blood versus bone marrow in patients with monoclonal gammopathy.Immunology. 2013 Jul;139(3):338-41. doi: 10.1111/imm.12082.
12 The immune inhibitory receptor LAIR-1 is highly expressed by plasmacytoid dendritic cells and acts complementary with NKp44 to control IFN production.PLoS One. 2010 Nov 30;5(11):e15080. doi: 10.1371/journal.pone.0015080.
13 Characterization of the recognition of tumor cells by the natural cytotoxicity receptor, NKp44.Biochemistry. 2007 Jun 26;46(25):7426-36. doi: 10.1021/bi7000455. Epub 2007 May 31.
14 Inflammation-restraining effects of prostaglandin E2 on natural killer-dendritic cell (NK-DC) interaction are imprinted during DC maturation.Blood. 2011 Sep 1;118(9):2473-82. doi: 10.1182/blood-2010-09-307835. Epub 2011 Jun 29.
15 Role of the NK cell-activating receptor CRACC in periodontitis.Infect Immun. 2013 Mar;81(3):690-6. doi: 10.1128/IAI.00895-12. Epub 2012 Dec 17.
16 Natural Killer Cells Control Tumor Growth by Sensing a Growth Factor.Cell. 2018 Jan 25;172(3):534-548.e19. doi: 10.1016/j.cell.2017.11.037. Epub 2017 Dec 21.
17 Interleukin-22 and interleukin-22-producing NKp44+ natural killer cells in subclinical gut inflammation in ankylosing spondylitis.Arthritis Rheum. 2012 Jun;64(6):1869-78. doi: 10.1002/art.34355. Epub 2011 Dec 27.
18 NKp44 and NKp30 splice variant profiles in decidua and tumor tissues: a comparative viewpoint.Oncotarget. 2016 Oct 25;7(43):70912-70923. doi: 10.18632/oncotarget.12292.
19 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.