General Information of Drug Off-Target (DOT) (ID: OT2S0GK8)

DOT Name Golgin subfamily B member 1 (GOLGB1)
Synonyms 372 kDa Golgi complex-associated protein; GCP372; Giantin; Macrogolgin
Gene Name GOLGB1
Related Disease
Nephropathy ( )
Non-insulin dependent diabetes ( )
Advanced cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Cardiac failure ( )
Congestive heart failure ( )
HIV infectious disease ( )
Morquio syndrome ( )
Neoplasm ( )
Obesity ( )
Osteochondrodysplasia ( )
Red-green color blindness ( )
Gingivitis ( )
Hepatocellular carcinoma ( )
Stroke ( )
Cleft palate ( )
Emery-Dreifuss muscular dystrophy ( )
Isolated cleft palate ( )
UniProt ID
GOGB1_HUMAN
Sequence
MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQL
VVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGT
VLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEELISTLQAQLTQAQAEQPAQSST
EMEEFVMMKQQLQEKEEFISTLQAQLSQTQAEQAAQQVVREKDARFETQVRLHEDELLQL
VTQADVETEMQQKLRVLQRKLEEHEESLVGRAQVVDLLQQELTAAEQRNQILSQQLQQME
AEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELE
SRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTI
QQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQKRVVEL
ENEKGALLLSSIELEELKAENEKLSSQITLLEAQNRTGEADREVSEISIVDIANKRSSSA
EESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFLKLQLQGKRAEEADHEVLDQKEMKQ
MEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVEKEQASTEHQSRTSEEISLNDAGVE
LKSTKQDGDKSLSAVPDIGQCHQDELERLKSQILELELNFHKAQEIYEKNLDEKAKEISN
LNQLIEEFKKNADNNSSAFTALSEERDQLLSQVKELSMVTELRAQVKQLEMNLAEAERQR
RLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQNELDDVQLQFSEQSTLIRSLQSQL
QNKESEVLEGAERVRHISSKVEELSQALSQKELEITKMDQLLLEKKRDVETLQQTIEEKD
QQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLNLLSRAEEAKKEQVEEDNEVSSGLK
QNYDEMSPAGQISKEELQHEFDLLKKENEQRKRKLQAALINRKELLQRVSRLEEELANLK
DESKKEIPLSETERGEVEEDKENKEYSEKCVTSKCQEIEIYLKQTISEKEVELQHIRKDL
EEKLAAEEQFQALVKQMNQTLQDKTNQIDLLQAEISENQAIIQKLITSNTDASDGDSVAL
VKETVVISPPCTGSSEHWKPELEEKILALEKEKEQLQKKLQEALTSRKAILKKAQEKERH
LREELKQQKDDYNRLQEQFDEQSKENENIGDQLRQLQIQVRESIDGKLPSTDQQESCSST
PGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIKAQLKEIEAEKVE
LELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESLKTVSHEAEVHAESLQQKLESSQLQ
IAGLEHLRELQPKLDELQKLISKKEEDVSYLSGQLSEKEAALTKIQTEIIEQEDLIKALH
TQLEMQAKEHDERIKQLQVELCEMKQKPEEIGEESRAKQQIQRKLQAALISRKEALKENK
SLQEELSLARGTIERLTKSLADVESQVSAQNKEKDTVLGRLALLQEERDKLITEMDRSLL
ENQSLSSSCESLKLALEGLTEDKEKLVKEIESLKSSKIAESTEWQEKHKELQKEYEILLQ
SYENVSNEAERIQHVVEAVRQEKQELYGKLRSTEANKKETEKQLQEAEQEMEEMKEKMRK
FAKSKQQKILELEEENDRLRAEVHPAGDTAKECMETLLSSNASMKEELERVKMEYETLSK
KFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEATEKHDNQTNVTEEGTQSIPGETEEQ
DSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNK
EFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELSRVTKLKETAEEEKD
DLEERLMNQLAELNGSIGNYCQDVTDAQIKNELLESEMKNLKKCVSELEEEKQQLVKEKT
KVESEIRKEYLEKIQGAQKEPGNKSHAKELQELLKEKQQEVKQLQKDCIRYQEKISALER
TVKALEFVQTESQKDLEITKENLAQAVEHRKKAQAELASFKVLLDDTQSEAARVLADNLK
LKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLKEKKNMQEKLDALRREKVHLEETIG
EIQVTLNKKDKEVQQLQENLDSTVTQLAAFTKSMSSLQDDRDRVIDEAKKWERKFSDAIQ
SKEEEIRLKEDNCSVLKDQLRQMSIHMEELKINISRLEHDKQIWESKAQTEVQLQQKVCD
TLQGENKELLSQLEETRHLYHSSQNELAKLESELKSLKDQLTDLSNSLEKCKEQKGNLEG
IIRQQEADIQNSKFSYEQLETDLQASRELTSRLHEEINMKEQKIISLLSGKEEAIQVAIA
ELRQQHDKEIKELENLLSQEEEENIVLEEENKKAVDKTNQLMETLKTIKKENIQQKAQLD
SFVKSMSSLQNDRDRIVGDYQQLEERHLSIILEKDQLIQEAAAENNKLKEEIRGLRSHMD
DLNSENAKLDAELIQYREDLNQVITIKDSQQKQLLEVQLQQNKELENKYAKLEEKLKESE
EANEDLRRSFNALQEEKQDLSKEIESLKVSISQLTRQVTALQEEGTLGLYHAQLKVKEEE
VHRLSALFSSSQKRIAELEEELVCVQKEAAKKVGEIEDKLKKELKHLHHDAGIMRNETET
AEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHANEELDELKRK
YDASLKELAQLKEQGLLNRERDALLSETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLHL
SSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEEGKQRSAAQPSTSPAEVQSLK
KAMSSLQNDRDRLLKELKNLQQQYLQINQEITELHPLKAQLQEYQDKTKAFQIMQEELRQ
ENLSWQHELHQLRMEKSSWEIHERRMKEQYLMAISDKDQQLSHLQNLIRELRSSSSQTQP
LKVQYQRQASPETSASPDGSQNLVYETELLRTQLNDSLKEIHQKELRIQQLNSNFSQLLE
EKNTLSIQLCDTSQSLRENQQHYGDLLNHCAVLEKQVQELQAGPLNIDVAPGAPQEKNGV
HRKSDPEELREPQQSFSEAQQQLCNTRQEVNELRKLLEEERDQRVAAENALSVAEEQIRR
LEHSEWDSSRTPIIGSCGTQEQALLIDLTSNSCRRTRSGVGWKRVLRSLCHSRTRVPLLA
AIYFLMIHVLLILCFTGHL
Function May participate in forming intercisternal cross-bridges of the Golgi complex.
Reactome Pathway
COPI-mediated anterograde transport (R-HSA-6807878 )
Signaling by FLT3 fusion proteins (R-HSA-9703465 )
Golgi Associated Vesicle Biogenesis (R-HSA-432722 )

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nephropathy DISXWP4P Definitive Biomarker [1]
Non-insulin dependent diabetes DISK1O5Z Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Genetic Variation [3]
Arteriosclerosis DISK5QGC Strong Biomarker [4]
Atherosclerosis DISMN9J3 Strong Biomarker [4]
Cardiac failure DISDC067 Strong Biomarker [5]
Congestive heart failure DIS32MEA Strong Biomarker [5]
HIV infectious disease DISO97HC Strong Biomarker [6]
Morquio syndrome DIS2Y2P2 Strong Altered Expression [7]
Neoplasm DISZKGEW Strong Genetic Variation [3]
Obesity DIS47Y1K Strong Biomarker [8]
Osteochondrodysplasia DIS9SPWW Strong Altered Expression [7]
Red-green color blindness DISV3ZVU Strong Genetic Variation [9]
Gingivitis DISC8RMX moderate Biomarker [10]
Hepatocellular carcinoma DIS0J828 moderate Genetic Variation [11]
Stroke DISX6UHX moderate Genetic Variation [12]
Cleft palate DIS6G5TF Limited Genetic Variation [13]
Emery-Dreifuss muscular dystrophy DISYTPR5 Limited Genetic Variation [14]
Isolated cleft palate DISV80CD Limited Genetic Variation [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Golgin subfamily B member 1 (GOLGB1). [15]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Golgin subfamily B member 1 (GOLGB1). [16]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Golgin subfamily B member 1 (GOLGB1). [17]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Golgin subfamily B member 1 (GOLGB1). [18]
Marinol DM70IK5 Approved Marinol increases the expression of Golgin subfamily B member 1 (GOLGB1). [19]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Golgin subfamily B member 1 (GOLGB1). [20]
Clozapine DMFC71L Approved Clozapine increases the expression of Golgin subfamily B member 1 (GOLGB1). [21]
Clorgyline DMCEUJD Approved Clorgyline increases the expression of Golgin subfamily B member 1 (GOLGB1). [22]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Golgin subfamily B member 1 (GOLGB1). [23]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Golgin subfamily B member 1 (GOLGB1). [24]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Golgin subfamily B member 1 (GOLGB1). [26]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Golgin subfamily B member 1 (GOLGB1). [27]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Golgin subfamily B member 1 (GOLGB1). [29]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Golgin subfamily B member 1 (GOLGB1). [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
DNCB DMDTVYC Phase 2 DNCB affects the binding of Golgin subfamily B member 1 (GOLGB1). [25]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Golgin subfamily B member 1 (GOLGB1). [28]
------------------------------------------------------------------------------------

References

1 Apolipoprotein M: Research progress, regulation and metabolic functions (Review).Mol Med Rep. 2015 Aug;12(2):1617-24. doi: 10.3892/mmr.2015.3658. Epub 2015 Apr 22.
2 Comparison of Great Curvature Plication with Duodenal-Jejunal Bypass (GCP-DJB) and Sleeve Gastrectomy (SG) on Metabolic Indices and Gut Hormones in Type 2 Diabetes Mellitus Rats.Obes Surg. 2018 Dec;28(12):4014-4021. doi: 10.1007/s11695-018-3459-6.
3 Gene polymorphisms of folate metabolizing enzymes and the risk of gastric cancer.Cancer Lett. 2007 Jun 28;251(2):228-36. doi: 10.1016/j.canlet.2006.11.021. Epub 2007 Jan 8.
4 Polymorphisms in three genes are associated with hemorrhagic stroke.Brain Behav. 2015 Oct 1;5(11):e00395. doi: 10.1002/brb3.395. eCollection 2015 Nov.
5 Cardiac overexpression of the norepinephrine transporter uptake-1 results in marked improvement of heart failure.Circ Res. 2005 Oct 28;97(9):928-36. doi: 10.1161/01.RES.0000186685.46829.E5. Epub 2005 Sep 15.
6 Macrogolgin--a new 376 kD Golgi complex outer membrane protein as target of antibodies in patients with rheumatic diseases and HIV infections.J Autoimmun. 1994 Feb;7(1):67-91. doi: 10.1006/jaut.1994.1006.
7 Giantin is required for coordinated production of aggrecan, link protein and type XI collagen during chondrogenesis.Biochem Biophys Res Commun. 2018 May 15;499(3):459-465. doi: 10.1016/j.bbrc.2018.03.163. Epub 2018 Mar 27.
8 Greater Curvature Plication with Duodenal-Jejunal Bypass: a Novel Metabolic Surgery for Type 2 Diabetes Mellitus.Obes Surg. 2018 Jun;28(6):1595-1601. doi: 10.1007/s11695-017-3057-z.
9 A contiguous, 3-Mb physical map of Xq28 extending from the colorblindness locus to DXS15.Am J Hum Genet. 1989 Dec;45(6):873-82.
10 The effect of nonsurgical periodontal treatment on gingival crevicular fluid stress hormone levels: A prospective study.Oral Dis. 2019 Jan;25(1):250-257. doi: 10.1111/odi.12973. Epub 2018 Sep 27.
11 Mutations acquired by hepatocellular carcinoma recurrence give rise to an aggressive phenotype.Oncotarget. 2017 Apr 4;8(14):22903-22916. doi: 10.18632/oncotarget.14248.
12 Genetic mapping and exome sequencing identify 2 mutations associated with stroke protection in pediatric patients with sickle cell anemia.Blood. 2013 Apr 18;121(16):3237-45. doi: 10.1182/blood-2012-10-464156. Epub 2013 Feb 19.
13 Association between GOLGB1 tag-polymorphisms and nonsyndromic cleft palate only in the Brazilian population.Ann Hum Genet. 2018 Jul;82(4):227-231. doi: 10.1111/ahg.12242. Epub 2018 Feb 12.
14 Assignment of Emery-Dreifuss muscular dystrophy to the distal region of Xq28: the results of a collaborative study.Am J Hum Genet. 1991 Mar;48(3):468-80.
15 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
16 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
17 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
18 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
19 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
20 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
21 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
22 Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
23 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
24 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
25 Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
26 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
27 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
28 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
29 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
30 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.