Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3HYKYI)

• DOT Name: Beta-enolase (ENO3)
• Synonyms: EC 4.2.1.11; 2-phospho-D-glycerate hydro-lyase; Enolase 3; Muscle-specific enolase; MSE; Skeletal muscle enolase
• Gene Name: ENO3
• Related Disease:
  Aortic valve stenosis
  Glycogen storage disease due to muscle beta-enolase deficiency
  Lung cancer
  Lung carcinoma
  Metabolic disorder
  Non-alcoholic fatty liver disease
  High blood pressure
  Metabolic myopathy
  Periodontitis
• UniProt ID: ENOB_HUMAN
• PDB ID: 2XSX
• EC Number: 4.2.1.11
• Pfam ID: PF00113 ; PF03952
• Sequence:
  MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGK
  GVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK
  AGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKE
  AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV
  VIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDD
  WATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA
  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
  AIFAGRKFRNPKAK
• Function: Glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. Appears to have a function in striated muscle development and regeneration.
• Tissue Specificity: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
• KEGG Pathway:
  Glycolysis / Gluconeogenesis (hsa00010)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
  R. degradation (hsa03018)
  HIF-1 sig.ling pathway (hsa04066)
  Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway:
  Gluconeogenesis (R-HSA-70263)
  Glycolysis (R-HSA-70171)
• BioCyc Pathway: MetaCyc:ENSG00000108515-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Aortic valve stenosis	DISW7AQ9	Strong	Biomarker	[1]
Glycogen storage disease due to muscle beta-enolase deficiency	DISMY8FA	Strong	Autosomal recessive	[2]
Lung cancer	DISCM4YA	Strong	Biomarker	[3]
Lung carcinoma	DISTR26C	Strong	Biomarker	[3]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[4]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Altered Expression	[5]
High blood pressure	DISY2OHH	moderate	Biomarker	[6]
Metabolic myopathy	DISSE3BW	Limited	Biomarker	[7]
Periodontitis	DISI9JOI	Limited	Biomarker	[8]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Beta-enolase (ENO3).	[9]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Beta-enolase (ENO3).	[10]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Beta-enolase (ENO3).	[11]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Beta-enolase (ENO3).	[12]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Beta-enolase (ENO3).	[13]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Beta-enolase (ENO3).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Beta-enolase (ENO3).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Beta-enolase (ENO3).	[16]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Beta-enolase (ENO3).	[17]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Beta-enolase (ENO3).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Beta-enolase (ENO3).	[19]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Beta-enolase (ENO3).	[20]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Beta-enolase (ENO3).	[13]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Beta-enolase (ENO3).	[21]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Beta-enolase (ENO3).	[22]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Beta-enolase (ENO3).	[23]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Beta-enolase (ENO3).	[24]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Beta-enolase (ENO3).	[25]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Beta-enolase (ENO3).	[17]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Beta-enolase (ENO3).	[26]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Beta-enolase (ENO3).	[14]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Beta-enolase (ENO3).	[28]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Beta-enolase (ENO3).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Beta-enolase (ENO3).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Beta-enolase (ENO3).	[31]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Beta-enolase (ENO3).	[32]
Daidzein	DMRFTJX	Investigative	Daidzein decreases the expression of Beta-enolase (ENO3).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Beta-enolase (ENO3).	[27]

References

• [1] Differential expression of alpha- and beta-enolase genes during rat heart development and hypertrophy.Am J Physiol. 1995 Dec;269(6 Pt 2):H1843-51. doi: 10.1152/ajpheart.1995.269.6.H1843.
• [2] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [3] Overexpression and Selective Anticancer Efficacy of ENO3 in STK11 Mutant Lung Cancers.Mol Cells. 2019 Nov 30;42(11):804-809. doi: 10.14348/molcells.2019.0099.
• [4] Myopathies Related to Glycogen Metabolism Disorders.Neurotherapeutics. 2018 Oct;15(4):915-927. doi: 10.1007/s13311-018-00684-2.
• [5] Integrated Analysis of Multiple Microarray Studies to Identify Novel Gene Signatures in Non-alcoholic Fatty Liver Disease.Front Endocrinol (Lausanne). 2019 Aug 30;10:599. doi: 10.3389/fendo.2019.00599. eCollection 2019.
• [6] Association Study of Common Variants in PFN1 With Hypertension in a Han Chinese Population: A Case-Control Study and A Follow-up Study.Am J Hypertens. 2017 Oct 1;30(10):1024-1031. doi: 10.1093/ajh/hpx089.
• [7] Recurrent rhabdomyolysis due to muscle -enolase deficiency: very rare or underestimated?.J Neurol. 2014 Dec;261(12):2424-8. doi: 10.1007/s00415-014-7512-7. Epub 2014 Sep 30.
• [8] Dysbiosis in chronic periodontitis: Key microbial players and interactions with the human host.Sci Rep. 2017 Jun 16;7(1):3703. doi: 10.1038/s41598-017-03804-8.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [12] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [13] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [14] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [17] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [18] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [19] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [20] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [21] Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
• [22] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [23] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [24] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [25] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [26] Resveratrol-induced cell growth inhibition and apoptosis is associated with modulation of phosphoglycerate mutase B in human prostate cancer cells: two-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis and mass spectrometry evaluation. Cancer Detect Prev. 2004;28(6):443-52. doi: 10.1016/j.cdp.2004.08.009.
• [27] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [30] Metabolomic modulations of HepG2 cells exposed to bisphenol analogues. Environ Int. 2019 Aug;129:59-67. doi: 10.1016/j.envint.2019.05.008. Epub 2019 May 20.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.