Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7MDJMN)

• DOT Name: Proline/serine-rich coiled-coil protein 1 (PSRC1)
• Gene Name: PSRC1
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
  Carotid artery disease
  Coronary atherosclerosis
  Coronary heart disease
  Lung carcinoma
  Myocardial infarction
  Pancreatic cancer
• UniProt ID: PSRC1_HUMAN
• Pfam ID: PF15259
• Sequence:
  MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQ
  GVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLK
  DSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNL
  FPASKSPASSPLTRSTPPVRGRAGPSGRAAASEETRAAKLRVSGSGEFVGLTLKFLHPSP
  PGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPG
  RGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNLQPPRKVAVPG
  PTR
• Function: Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Increases the rate of turnover of microtubules on metaphase spindles, and contributes to the generation of normal tension across sister kinetochores. Recruits KIF2A and ANKRD53 to the mitotic spindle and spindle poles. May participate in p53/TP53-regulated growth suppression.
• Tissue Specificity: Widely expressed in adult and fetal tissues, with highest expression in the adult brain and fetal thymus. Not detected in adult skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[1]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[1]
Carotid artery disease	DISLRVLT	Strong	Genetic Variation	[2]
Coronary atherosclerosis	DISKNDYU	Strong	Altered Expression	[3]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[4]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[5]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[6]
Pancreatic cancer	DISJC981	Strong	Biomarker	[7]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[8]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[9]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[10]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[11]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[12]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[13]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[14]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[15]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[17]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[18]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[19]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[20]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[18]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[21]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[18]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[27]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[28]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[29]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Proline/serine-rich coiled-coil protein 1 (PSRC1).	[26]

References

• [1] The impact of PSRC1 overexpression on gene and transcript expression profiling in the livers of ApoE(-/-) mice fed a high-fat diet.Mol Cell Biochem. 2020 Feb;465(1-2):125-139. doi: 10.1007/s11010-019-03673-x. Epub 2019 Dec 14.
• [2] Analysis of recently identified dyslipidemia alleles reveals two loci that contribute to risk for carotid artery disease.Lipids Health Dis. 2009 Dec 1;8:52. doi: 10.1186/1476-511X-8-52.
• [3] PSRC1 overexpression attenuates atherosclerosis progression in apoE(-/-) mice by modulating cholesterol transportation and inflammation.J Mol Cell Cardiol. 2018 Mar;116:69-80. doi: 10.1016/j.yjmcc.2018.01.013. Epub 2018 Feb 3.
• [4] There is an association between a genetic polymorphism in the ZNF259 gene involved in lipid metabolism and coronary artery disease.Gene. 2019 Jul 1;704:80-85. doi: 10.1016/j.gene.2019.02.101. Epub 2019 Mar 19.
• [5] Identification of a novel mouse p53 target gene DDA3.Oncogene. 1999 Dec 16;18(54):7765-74. doi: 10.1038/sj.onc.1203167.
• [6] Association of six genetic variants with myocardial infarction.Int J Mol Med. 2015 May;35(5):1451-9. doi: 10.3892/ijmm.2015.2115. Epub 2015 Feb 27.
• [7] Integrated regulatory network involving differently expressed genes and protein-protein interaction on pancreatic cancer.Eur Rev Med Pharmacol Sci. 2015 Jul;19(13):2423-8.
• [8] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [10] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [11] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [12] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [13] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [14] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [15] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [16] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [17] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [18] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [19] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [20] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [21] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [22] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [23] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [27] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [28] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [29] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [30] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.