Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8ZYC7G)

DOT Name Testisin (PRSS21)
Synonyms EC 3.4.21.-; Eosinophil serine protease 1; ESP-1; Serine protease 21
Gene Name PRSS21
Related Disease
Adult germ cell tumor ( )
Alzheimer disease ( )
Atrial fibrillation ( )
Behcet disease ( )
Cervical cancer ( )
Cervical carcinoma ( )
Epithelial ovarian cancer ( )
Germ cell tumor ( )
Germ cell tumour ( )
Hemiplegia ( )
Hepatitis B virus infection ( )
HIV infectious disease ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Parkinson disease ( )
Sleep disorder ( )
Stroke ( )
Type-1/2 diabetes ( )
Alcohol dependence ( )
Neoplasm ( )
UniProt ID
TEST_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.21.-
Pfam ID
PF00089
Sequence
MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLR
LWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYF
VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIK
EDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGG
PLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLL
FFPLLWALPLLGPV
Function Could regulate proteolytic events associated with testicular germ cell maturation.
Tissue Specificity Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.
Reactome Pathway
Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult germ cell tumor DISJUCQ7 Strong Biomarker [1]
Alzheimer disease DISF8S70 Strong Genetic Variation [2]
Atrial fibrillation DIS15W6U Strong Genetic Variation [3]
Behcet disease DISSYMBS Strong Altered Expression [4]
Cervical cancer DISFSHPF Strong Biomarker [5]
Cervical carcinoma DIST4S00 Strong Biomarker [5]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [6]
Germ cell tumor DIS62070 Strong Biomarker [1]
Germ cell tumour DISOF3TK Strong Biomarker [1]
Hemiplegia DISVVH6I Strong Biomarker [7]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [8]
HIV infectious disease DISO97HC Strong Biomarker [9]
Ovarian cancer DISZJHAP Strong Biomarker [6]
Ovarian neoplasm DISEAFTY Strong Biomarker [6]
Parkinson disease DISQVHKL Strong Biomarker [10]
Sleep disorder DIS3JP1U Strong Biomarker [11]
Stroke DISX6UHX Strong Genetic Variation [7]
Type-1/2 diabetes DISIUHAP Strong Biomarker [12]
Alcohol dependence DIS4ZSCO moderate Genetic Variation [13]
Neoplasm DISZKGEW Limited Posttranslational Modification [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Testisin (PRSS21). [15]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Testisin (PRSS21). [17]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Testisin (PRSS21). [16]
------------------------------------------------------------------------------------

References

1 Epigenetic silencing of the putative tumor suppressor gene testisin in testicular germ cell tumors.J Cancer Res Clin Oncol. 2006 Dec;132(12):765-70. doi: 10.1007/s00432-006-0124-6. Epub 2006 Jun 21.
2 A point-based tool to predict conversion from mild cognitive impairment to probable Alzheimer's disease.Alzheimers Dement. 2014 Nov;10(6):646-55. doi: 10.1016/j.jalz.2013.12.014. Epub 2014 Feb 1.
3 Genetic risk for atrial fibrillation could motivate patient adherence to warfarin therapy: a cost effectiveness analysis.BMC Cardiovasc Disord. 2015 Sep 29;15:104. doi: 10.1186/s12872-015-0100-7.
4 Interaction between temperature and sublethal infection with the amphibian chytrid fungus impacts a susceptible frog species.Sci Rep. 2019 Jan 14;9(1):83. doi: 10.1038/s41598-018-35874-7.
5 Predictors of Cervical Cancer Screening Among Infrequently Screened Women Completing Human Papillomavirus Self-Collection: My Body My Test-1.J Womens Health (Larchmt). 2019 Aug;28(8):1094-1104. doi: 10.1089/jwh.2018.7141. Epub 2019 Mar 15.
6 PRSS21/testisin inhibits ovarian tumor metastasis and antagonizes proangiogenic angiopoietins ANG2 and ANGPTL4.J Mol Med (Berl). 2019 May;97(5):691-709. doi: 10.1007/s00109-019-01763-3. Epub 2019 Mar 25.
7 Echocardiography-guided aortic cannulation by the Seldinger technique for type A dissection with cerebral malperfusion.J Thorac Cardiovasc Surg. 2020 Mar;159(3):784-793. doi: 10.1016/j.jtcvs.2019.02.097. Epub 2019 Mar 13.
8 Transcription and regulation of hepatitis B virus genes in host sperm cells.Asian J Androl. 2018 May-Jun;20(3):284-289. doi: 10.4103/aja.aja_46_17.
9 CD4 cell count variability with repeat testing in South Africa: Should reporting include both absolute counts and ranges of plausible values?.Int J STD AIDS. 2018 Nov;29(11):1048-1056. doi: 10.1177/0956462418771768. Epub 2018 May 11.
10 Use of Overlapping Group LASSO Sparse Deep Belief Network to Discriminate Parkinson's Disease and Normal Control.Front Neurosci. 2019 Apr 29;13:396. doi: 10.3389/fnins.2019.00396. eCollection 2019.
11 The association between sleep dysfunction and psychosis-like experiences among college students.Psychiatry Res. 2017 Feb;248:6-12. doi: 10.1016/j.psychres.2016.12.009. Epub 2016 Dec 11.
12 Impact of mismatches in HbA(1c) vs glucose values on the diagnostic classification of diabetes and prediabetes.Diabet Med. 2020 Apr;37(4):689-696. doi: 10.1111/dme.14181. Epub 2019 Dec 15.
13 A functional polymorphism in the MAOA gene promoter (MAOA-LPR) predicts central dopamine function and body mass index.Mol Psychiatry. 2006 Sep;11(9):858-66. doi: 10.1038/sj.mp.4001856. Epub 2006 Jun 13.
14 The epigenome of testicular germ cell tumors.APMIS. 2007 Oct;115(10):1147-60. doi: 10.1111/j.1600-0463.2007.apm_660.xml.x.
15 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
16 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.