Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAD4JZ0)

DOT Name Basic salivary proline-rich protein 2 (PRB2)
Synonyms Salivary proline-rich protein; Con1 glycoprotein
Gene Name PRB2
Related Disease
Bone osteosarcoma ( )
Osteosarcoma ( )
Brain cancer ( )
Brain neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Colorectal neoplasm ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Idiopathic thrombocytopenic purpura ( )
Lung cancer ( )
Neoplasm ( )
Ovarian cancer ( )
Retinoblastoma ( )
Squamous cell carcinoma ( )
Thrombocytopenia ( )
Von willebrand disease ( )
Coronary heart disease ( )
Lung carcinoma ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Recessive X-linked ichthyosis ( )
Sarcoma ( )
Soft tissue sarcoma ( )
Coagulation defect ( )
Advanced cancer ( )
Gastric cancer ( )
Glanzmann thrombasthenia ( )
Mesothelioma ( )
Neuroblastoma ( )
Stomach cancer ( )
Von Willebrand disease type 2A ( )
Von Willebrand disease type 2B ( )
UniProt ID
PRB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15240
Sequence
MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGAPPQGGNKPQGPPSPPGKPQGP
PPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQG
PPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRSPPGKP
QGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARSPPG
KPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSRSSRSP
PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSRSAR
SPPGKPQGPPQQEGNNPQGPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ
KEGG Pathway
Salivary secretion (hsa04970 )

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bone osteosarcoma DIST1004 Definitive Biomarker [1]
Osteosarcoma DISLQ7E2 Definitive Biomarker [1]
Brain cancer DISBKFB7 Strong Altered Expression [2]
Brain neoplasm DISY3EKS Strong Altered Expression [2]
Breast cancer DIS7DPX1 Strong Altered Expression [3]
Breast carcinoma DIS2UE88 Strong Altered Expression [3]
Colorectal neoplasm DISR1UCN Strong Biomarker [4]
Endometrial cancer DISW0LMR Strong Altered Expression [5]
Endometrial carcinoma DISXR5CY Strong Altered Expression [5]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [6]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [7]
Hepatitis C virus infection DISQ0M8R Strong Altered Expression [8]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [8]
Idiopathic thrombocytopenic purpura DISFKGJU Strong Biomarker [9]
Lung cancer DISCM4YA Strong Genetic Variation [10]
Neoplasm DISZKGEW Strong Biomarker [11]
Ovarian cancer DISZJHAP Strong Altered Expression [6]
Retinoblastoma DISVPNPB Strong Altered Expression [8]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [12]
Thrombocytopenia DISU61YW Strong Genetic Variation [13]
Von willebrand disease DIS3TZCH Strong Biomarker [14]
Coronary heart disease DIS5OIP1 moderate Genetic Variation [15]
Lung carcinoma DISTR26C moderate Genetic Variation [10]
Ovarian neoplasm DISEAFTY moderate Biomarker [16]
Pancreatic cancer DISJC981 moderate Genetic Variation [17]
Recessive X-linked ichthyosis DISZY56W moderate Altered Expression [18]
Sarcoma DISZDG3U moderate Altered Expression [18]
Soft tissue sarcoma DISSN8XB moderate Altered Expression [18]
Coagulation defect DIS9X3H6 Disputed Genetic Variation [19]
Advanced cancer DISAT1Z9 Limited Biomarker [11]
Gastric cancer DISXGOUK Limited Biomarker [11]
Glanzmann thrombasthenia DISFGGTG Limited Genetic Variation [20]
Mesothelioma DISKWK9M Limited Biomarker [21]
Neuroblastoma DISVZBI4 Limited Altered Expression [22]
Stomach cancer DISKIJSX Limited Biomarker [11]
Von Willebrand disease type 2A DISTAHJN Limited Genetic Variation [23]
Von Willebrand disease type 2B DISLHZRK Limited Genetic Variation [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Basic salivary proline-rich protein 2 (PRB2). [25]
------------------------------------------------------------------------------------

References

1 Triggering of p73-dependent apoptosis in osteosarcoma is under the control of E2Fs-pRb2/p130 complexes.Oncogene. 2003 Jun 5;22(23):3518-29. doi: 10.1038/sj.onc.1206487.
2 Rb family proteins in gastric cancer (review).Oncol Rep. 2010 Dec;24(6):1411-8. doi: 10.3892/or_00001000.
3 In vitro cytotoxic potential of friedelin in human MCF-7 breast cancer cell: Regulate early expression of Cdkn2a and pRb1, neutralize mdm2-p53 amalgamation and functional stabilization of p53.Exp Toxicol Pathol. 2017 Oct 2;69(8):630-636. doi: 10.1016/j.etp.2017.05.011. Epub 2017 Jun 12.
4 Enterocyte differentiation is compatible with SV40 large T expression and loss of p53 function in human colonic Caco-2 cells. Status of the pRb1 and pRb2 tumor suppressor gene products.FEBS Lett. 1997 Apr 14;406(3):234-42. doi: 10.1016/s0014-5793(97)00208-1.
5 Expression of the retinoblastoma-related gene Rb2/p130 correlates with clinical outcome in endometrial cancer.J Clin Oncol. 1998 Mar;16(3):1085-93. doi: 10.1200/JCO.1998.16.3.1085.
6 Frequent loss of pRb2/p130 in human ovarian carcinoma.Clin Cancer Res. 2004 May 1;10(9):3098-103. doi: 10.1158/1078-0432.ccr-03-0524.
7 Clinicopathological significance of pRb2/p130 expression in squamous cell carcinoma of the esophagus.J Cancer Res Clin Oncol. 2002 Dec;128(12):691-6. doi: 10.1007/s00432-002-0395-5. Epub 2002 Nov 26.
8 Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation.J Exp Clin Cancer Res. 2015 Nov 14;34:140. doi: 10.1186/s13046-015-0255-1.
9 Akt-mediated platelet apoptosis and its therapeutic implications in immune thrombocytopenia.Proc Natl Acad Sci U S A. 2018 Nov 6;115(45):E10682-E10691. doi: 10.1073/pnas.1808217115. Epub 2018 Oct 18.
10 Tumor-specific exon 1 mutations could be the 'hit event' predisposing Rb2/p130 gene to epigenetic silencing in lung cancer.Oncogene. 2005 Sep 1;24(38):5821-6. doi: 10.1038/sj.onc.1208880.
11 pRb2/p130 localizes to the cytoplasm in diffuse gastric cancer.J Cell Physiol. 2015 Apr;230(4):802-5. doi: 10.1002/jcp.24805.
12 PRb2/p130, p107 and p53 expression in precancerous lesions and squamous cell carcinoma of the uterine cervix.Anticancer Res. 2005 May-Jun;25(3B):2187-92.
13 A Novel Homozygous c.800C>G Substitution in GP1BA Exon 2 in a Kuwaiti Family with Bernard-Soulier Syndrome.Acta Haematol. 2015;134(3):193-8. doi: 10.1159/000381328. Epub 2015 May 28.
14 Impact of thrombogenic mutations on clinical phenotypes of von Willebrand disease.Clin Appl Thromb Hemost. 2010 Jun;16(3):281-7. doi: 10.1177/1076029609351291. Epub 2009 Dec 2.
15 Coronary artery disease and polymorphisms in a receptor mediating shear stress-dependent platelet activation.Circulation. 1997 Nov 18;96(10):3281-6. doi: 10.1161/01.cir.96.10.3281.
16 pRb2/p130 decreases sensitivity to apoptosis induced by camptothecin and doxorubicin but not by taxol. Clin Cancer Res. 2004 Dec 1;10(23):8085-93. doi: 10.1158/1078-0432.CCR-04-0996.
17 Genetic polymorphisms associated with pancreatic cancer survival: a genome-wide association study.Int J Cancer. 2017 Aug 15;141(4):678-686. doi: 10.1002/ijc.30762. Epub 2017 May 15.
18 The retinoblastoma family member pRb2/p130 is an independent predictor of survival in human soft tissue sarcomas.Clin Cancer Res. 2008 Aug 1;14(15):4775-9. doi: 10.1158/1078-0432.CCR-07-4055.
19 Correction of murine Bernard-Soulier syndrome by lentivirus-mediated gene therapy.Mol Ther. 2012 Mar;20(3):625-32. doi: 10.1038/mt.2011.231. Epub 2011 Nov 1.
20 Inherited platelet disorders and oral health.J Oral Pathol Med. 2013 Feb;42(2):115-24. doi: 10.1111/j.1600-0714.2012.01151.x. Epub 2012 May 15.
21 The retinoblastoma gene family pRb/p105, p107, pRb2/p130 and simian virus-40 large T-antigen in human mesotheliomas.Nat Med. 1997 Aug;3(8):913-6. doi: 10.1038/nm0897-913.
22 Retinoblastoma-related protein pRb2/p130 and its binding to the B-myb promoter increase during human neuroblastoma differentiation.J Cell Biochem. 1997 Dec 1;67(3):297-303.
23 C1272S: a new candidate mutation in type 2A von Willebrand disease that disrupts the disulfide loop responsible for the interaction of VWF with platelet GP Ib-IX.Am J Hematol. 2004 Feb;75(2):73-7. doi: 10.1002/ajh.10455.
24 von Willebrand factor mutation promotes thrombocytopathy by inhibiting integrin IIb3.J Clin Invest. 2013 Dec;123(12):5071-81. doi: 10.1172/JCI69458. Epub 2013 Nov 25.
25 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.