Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC0L12N)

DOT Name	Arylsulfatase F (ARSF)
Synonyms	ASF; EC 3.1.6.1
Gene Name	ARSF
Related Disease	Prostate cancer ( ) Prostate carcinoma ( ) Advanced cancer ( ) Androgen insensitivity syndrome ( ) Autosomal dominant vitreoretinochoroidopathy ( ) Gastric cancer ( ) Inflammatory bowel disease ( ) Influenza ( ) Lung neoplasm ( ) Malignant soft tissue neoplasm ( ) Metastatic malignant neoplasm ( ) Multiple sclerosis ( ) Myositis disease ( ) Neoplasm ( ) Progressive multifocal leukoencephalopathy ( ) Sarcoma ( ) Spinal muscular atrophy ( ) Squamous cell carcinoma ( ) Stomach cancer ( ) Systemic lupus erythematosus ( ) Viral hemorrhagic fever ( ) Vitelliform macular dystrophy ( ) Breast cancer ( ) Breast carcinoma ( ) Carcinoma of liver and intrahepatic biliary tract ( ) Liver cancer ( ) Neuroblastoma ( ) Non-small-cell lung cancer ( )
UniProt ID	ARSF_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.1.6.1
Pfam ID	PF00884 ; PF14707
Sequence	MRPRRPLVFMSLVCALLNTCQAHRVHDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDR LAREGVRLTQHISAASLCSPSRSAFLTGRYPIRSGMVSSGNRRVIQNLAVPAGLPLNETT LAALLKKQGYSTGLIGKWHQGLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRN TELAFESQLWLCVQLVAIAILTLTFGKLSGWVSVPWLLIFSMILFIFLLGYAWFSSHTSP LYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLERHSKETFLLFFSFLHVHTPLPTTD DFTGTSKHGLYGDNVEEMDSMVGKILDAIDDFGLRNNTLVYFTSDHGGHLEARRGHAQLG GWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQ DRVIDGRDLMPLLQGNVRHSEHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPP ASGGCYVTSLCRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKE HQETIVPVTYQLSELNQGRTWLKPCCGVFPFCLCDKEEEVSQPRGPNEKR
Function	Exhibits arylsulfatase activity towards the artificial substrate 4-methylumbelliferyl sulfate.
Reactome Pathway	Glycosphingolipid catabolism (R-HSA-9840310 ) The activation of arylsulfatases (R-HSA-1663150 )

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Prostate cancer	DISF190Y	Definitive	Altered Expression	[1]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Androgen insensitivity syndrome	DISUZBBO	Strong	Biomarker	[3]
Autosomal dominant vitreoretinochoroidopathy	DISXZJ1T	Strong	Genetic Variation	[4]
Gastric cancer	DISXGOUK	Strong	Biomarker	[5]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[6]
Influenza	DIS3PNU3	Strong	Biomarker	[7]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[8]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Altered Expression	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[10]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[11]
Myositis disease	DISCIXF0	Strong	Altered Expression	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Progressive multifocal leukoencephalopathy	DISX02WS	Strong	Biomarker	[14]
Sarcoma	DISZDG3U	Strong	Altered Expression	[9]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[15]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[16]
Stomach cancer	DISKIJSX	Strong	Biomarker	[5]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[17]
Viral hemorrhagic fever	DISQEBTU	Strong	Biomarker	[18]
Vitelliform macular dystrophy	DISEFYYN	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	moderate	Biomarker	[19]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[19]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[20]
Liver cancer	DISDE4BI	Limited	Biomarker	[20]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[22]
------------------------------------------------------------------------------------


⏷ Show the Full List of 28 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Arylsulfatase F (ARSF).	[23]
------------------------------------------------------------------------------------

References

1	miR?0c suppresses prostate cancer survival by targeting the ASF/SF2 splicing factor oncoprotein.Mol Med Rep. 2017 Sep;16(3):2431-2438. doi: 10.3892/mmr.2017.6910. Epub 2017 Jul 4.
2	Li-Fraumeni and Li-Fraumeni-like syndrome mutations in p53 are associated with exonic methylation and splicing regulatory elements.Mol Carcinog. 2009 Oct;48(10):895-902. doi: 10.1002/mc.20537.
3	Selective Fusion in Lenke 5 Adolescent Idiopathic Scoliosis.World Neurosurg. 2018 Oct;118:e784-e791. doi: 10.1016/j.wneu.2018.07.052. Epub 2018 Jul 18.
4	ADVIRC is caused by distinct mutations in BEST1 that alter pre-mRNA splicing. J Med Genet. 2009 Sep;46(9):620-5. doi: 10.1136/jmg.2008.059881. Epub 2008 Jul 8.
5	MALAT1 promotes cell proliferation in gastric cancer by recruiting SF2/ASF.Biomed Pharmacother. 2014 Jun;68(5):557-64. doi: 10.1016/j.biopha.2014.04.007. Epub 2014 Apr 28.
6	Vitamin C and B(3) as new biomaterials to alter intestinal stem cells.J Biomed Mater Res A. 2019 Sep;107(9):1886-1897. doi: 10.1002/jbm.a.36715. Epub 2019 May 23.
7	Highly pathogenic avian influenza virus nucleoprotein interacts with TREX complex adaptor protein Aly/REF.PLoS One. 2013 Sep 20;8(9):e72429. doi: 10.1371/journal.pone.0072429. eCollection 2013.
8	The oncoprotein SF2/ASF promotes non-small cell lung cancer survival by enhancing survivin expression.Clin Cancer Res. 2010 Aug 15;16(16):4113-25. doi: 10.1158/1078-0432.CCR-10-0076. Epub 2010 Aug 3.
9	The gene encoding the splicing factor SF2/ASF is a proto-oncogene.Nat Struct Mol Biol. 2007 Mar;14(3):185-93. doi: 10.1038/nsmb1209. Epub 2007 Feb 18.
10	Cell motility is controlled by SF2/ASF through alternative splicing of the Ron protooncogene.Mol Cell. 2005 Dec 22;20(6):881-90. doi: 10.1016/j.molcel.2005.10.026.
11	JC polyomavirus expression and bell-shaped regulation of its SF2/ASF suppressor during the follow-up of multiple sclerosis patients treated with natalizumab.J Neurovirol. 2017 Apr;23(2):226-238. doi: 10.1007/s13365-016-0492-x. Epub 2016 Nov 3.
12	Alternative splicing factor ASF/SF2 is down regulated in inflamed muscle.J Clin Pathol. 2006 Aug;59(8):855-61. doi: 10.1136/jcp.2005.032961. Epub 2006 Mar 30.
13	Alterations in expression pattern of splicing factors in epithelial ovarian cancer and its clinical impact.Int J Gynecol Cancer. 2013 Jul;23(6):990-6. doi: 10.1097/IGC.0b013e31829783e3.
14	Early reduction of the splicing factor2/alternative splicing factor: a cellular inhibitor of the JC polyomavirus in natalizumab-treated MS patients long before developing progressive multifocal leukoencephalopathy.J Neurovirol. 2020 Feb;26(1):133-137. doi: 10.1007/s13365-019-00793-4. Epub 2019 Aug 29.
15	Disruption of an SF2/ASF-dependent exonic splicing enhancer in SMN2 causes spinal muscular atrophy in the absence of SMN1.Nat Genet. 2002 Apr;30(4):377-84. doi: 10.1038/ng854. Epub 2002 Mar 4.
16	Identification of differentially expressed genes in chemically induced skin tumors.Mol Carcinog. 1997 Sep;20(1):88-98.
17	Splicing factor SF2/ASF rescues IL-2 production in T cells from systemic lupus erythematosus patients by activating IL-2 transcription.Proc Natl Acad Sci U S A. 2013 Jan 29;110(5):1845-50. doi: 10.1073/pnas.1214207110. Epub 2013 Jan 14.
18	In silico structural and functional prediction of African swine fever virus protein-B263R reveals features of a TATA-binding protein.PeerJ. 2018 Feb 22;6:e4396. doi: 10.7717/peerj.4396. eCollection 2018.
19	RRM1 domain of the splicing oncoprotein SRSF1 is required for MEK1-MAPK-ERK activation and cellular transformation.Carcinogenesis. 2013 Nov;34(11):2498-504. doi: 10.1093/carcin/bgt247. Epub 2013 Jul 10.
20	Label-free cytosensing of cancer cells based on the interaction between protein and an electron-transfer carbohydrate-mimetic peptide.Anal Chim Acta. 2018 Dec 21;1040:166-176. doi: 10.1016/j.aca.2018.08.025. Epub 2018 Aug 16.
21	MicroRNAs-10a and -10b contribute to retinoic acid-induced differentiation of neuroblastoma cells and target the alternative splicing regulatory factor SFRS1 (SF2/ASF).J Biol Chem. 2011 Feb 11;286(6):4150-64. doi: 10.1074/jbc.M110.167817. Epub 2010 Nov 30.
22	HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells.PLoS One. 2013 Apr 29;8(4):e62729. doi: 10.1371/journal.pone.0062729. Print 2013.
23	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.