Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCBP1BT)

• DOT Name: DEP domain-containing mTOR-interacting protein (DEPTOR)
• Synonyms: hDEPTOR; DEP domain-containing protein 6
• Gene Name: DEPTOR
• UniProt ID: DPTOR_HUMAN
• PDB ID: 7DKL; 7OWG; 7PE7; 7PE8; 7PE9; 7PEA; 7PEB; 7PEC; 7PED
• Pfam ID: PF00610
• Sequence:
  MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
  PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
  DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
  TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
  THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
  PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
  AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC
• Function: Negative regulator of the mTORC1 and mTORC2 complexes: inhibits the protein kinase activity of MTOR, thereby inactivating both complexes. DEPTOR inhibits mTORC1 and mTORC2 to induce autophagy. In contrast to AKT1S1/PRAS40, only partially inhibits mTORC1 activity.
• KEGG Pathway:
  Autophagy - animal (hsa04140)
  mTOR sig.ling pathway (hsa04150)

Molecular Interaction Atlas (MIA) of This DOT

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[8]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[9]
Menadione	DMSJDTY	Approved	Menadione affects the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[10]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[12]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[13]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[14]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[15]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[16]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[17]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[18]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[19]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[7]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[14]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[20]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[21]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[7]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[2]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[23]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[20]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[24]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[25]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[5]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[26]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[27]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of DEP domain-containing mTOR-interacting protein (DEPTOR).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of DEP domain-containing mTOR-interacting protein (DEPTOR).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [9] The human myometrium differentially expresses mTOR signalling components before and during pregnancy: evidence for regulation by progesterone. J Steroid Biochem Mol Biol. 2014 Jan;139:166-72. doi: 10.1016/j.jsbmb.2013.02.017. Epub 2013 Mar 26.
• [10] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [13] Differently expressed long noncoding RNAs and mRNAs in TK6 cells exposed to low dose hydroquinone. Oncotarget. 2017 Oct 4;8(56):95554-95567. doi: 10.18632/oncotarget.21481. eCollection 2017 Nov 10.
• [14] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [15] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [16] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [17] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [18] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [19] Androgen receptor functions as a negative transcriptional regulator of DEPTOR, mTOR inhibitor. J Toxicol Sci. 2015 Dec;40(6):753-8. doi: 10.2131/jts.40.753.
• [20] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [21] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [22] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [23] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [26] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [27] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [28] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.