Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCSVMAR)

DOT Name Protein MON2 homolog (MON2)
Synonyms Protein SF21
Gene Name MON2
Related Disease
Autoimmune disease ( )
Cardiac failure ( )
Congestive heart failure ( )
Coronary atherosclerosis ( )
Rheumatoid arthritis ( )
Visceral leishmaniasis ( )
Werner syndrome ( )
Coronary heart disease ( )
UniProt ID
MON2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16213 ; PF16206 ; PF09324 ; PF12783
Sequence
MSGTSSPEAVKKLLENMQSDLRALSLECKKKFPPVKEAAESGIIKVKTIAARNTEILAAL
KENSSEVVQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVSETAAGNIINMLWQLMENSLE
ELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNNTAAATVRQVVTVVFERM
VAEDERHRDIIEQPVLVQGNSNRRSVSTLKPCAKDAYMLFQDLCQLVNADAPYWLVGMTE
MTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPLVIKLFSPNIKFRQGSSTSSSPA
PVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLSLLVKFLDADKPQWLRAVAVESIH
RFCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSFIQSLFLVPPTGNPATSNQAGNNNL
GGSVSAPANSGMVGIGGGVTLLPAFEYRGTWIPILTITVQGSAKATYLEMLDKVEPPTIP
EGYAMSVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQSTSDQM
DKEIVSRAVWEEMVNACWCGLLAALSLLLDASTDEAATENILKAELTMAALCGRLGLVTS
RDAFITAICKGSLPPHYALTVLNTTTAATLSNKSYSVQGQSVMMISPSSESHQQVVAVGQ
PLAVQPQGTVMLTSKNIQCMRTLLNLAHCHGAVLGTSWQLVLATLQHLVWILGLKPSSGG
ALKPGRAVEGPSTVLTTAVMTDLPVISNILSRLFESSQYLDDVSLHHLINALCSLSLEAM
DMAYGNNKEPSLFAVAKLLETGLVNMHRIEILWRPLTGHLLEVCQHPNSRMREWGAEALT
SLIKAGLTFNHDPPLSQNQRLQLLLLNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLG
PGWPLVLGVMGAIRNDQGESLIRTAFQCLQLVVTDFLPTMPCTCLQIVVDVAGSFGLHNQ
ELNISLTSIGLLWNISDYFFQRGETIEKELNKEEAAQQKQAEEKGVVLNRPFHPAPPFDC
LWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVR
ESSTTADKEKIESGGGNILIHHSRDTAEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFS
RAWDVLLDHIQSAALSKNNEVSLAALKSFQEILQIVSPVRDSDKPETPPVVNVPVPVLIG
PISGMSRPFVRTDSIGEKLGRYSSSEPPIVTDELEDLNLWWAAWNTWYRIGSESTKPPIT
FDKLTFIPSQPFLTALIQIFPALYQHIKTGFNMDDLQKLGVILHSAISVPISSDASPFIL
PSYTEAVLTSLQEAVLTALDVLQKAICVGPENMQIMYPAIFDQLLAFVEFSCKPPQYGQL
ETKHIANAKYNQIQLFAPAEWVALNYVPFAERSLEVVVDLYQKTACHKAVVNEKVLQNII
KTLRVPLSLKYSCPSESTWKLAVSSLLRVLSIGLPVARQHASSGKFDSMWPELANTFEDF
LFTKSIPPDNLSIQEFQRNENIDVEVVQLISNEILPYANFIPKEFVGQIMTMLNKGSIHS
QSSSFTEAEIDIRLREEFSKMCFETLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLH
RYIEDERLSGKCPLPRQQVTEIIFVLKAVSTLIDSLKKTQPENVDGNTWAQVIALYPTLV
ECITCSSSEVCSALKEALVPFKDFMQPPASRVQNGES
Function Plays a role in regulating membrane trafficking of cargo proteins. Together with ATP9A and DOP1B, regulates SNX3 retromer-mediated endosomal sorting of WLS away from lysosomal degradation.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Strong Biomarker [1]
Cardiac failure DISDC067 Strong Biomarker [2]
Congestive heart failure DIS32MEA Strong Biomarker [2]
Coronary atherosclerosis DISKNDYU Strong Biomarker [3]
Rheumatoid arthritis DISTSB4J Strong Biomarker [1]
Visceral leishmaniasis DISTKEYK Strong Genetic Variation [4]
Werner syndrome DISZY45W moderate Biomarker [5]
Coronary heart disease DIS5OIP1 Limited Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Protein MON2 homolog (MON2). [6]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Protein MON2 homolog (MON2). [8]
Selenium DM25CGV Approved Selenium decreases the expression of Protein MON2 homolog (MON2). [9]
Progesterone DMUY35B Approved Progesterone increases the expression of Protein MON2 homolog (MON2). [10]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Protein MON2 homolog (MON2). [11]
Clorgyline DMCEUJD Approved Clorgyline increases the expression of Protein MON2 homolog (MON2). [12]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Protein MON2 homolog (MON2). [9]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Protein MON2 homolog (MON2). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein MON2 homolog (MON2). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Protein MON2 homolog (MON2). [17]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Protein MON2 homolog (MON2). [18]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Protein MON2 homolog (MON2). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic increases the methylation of Protein MON2 homolog (MON2). [7]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Protein MON2 homolog (MON2). [13]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Protein MON2 homolog (MON2). [14]
------------------------------------------------------------------------------------

References

1 Platelets induce a proinflammatory phenotype in monocytes via the CD147 pathway in rheumatoid arthritis.Arthritis Res Ther. 2014 Nov 18;16(6):478. doi: 10.1186/s13075-014-0478-0.
2 Mon2 predicts poor outcome in ST-elevation myocardial infarction.J Intern Med. 2019 Mar;285(3):301-316. doi: 10.1111/joim.12847. Epub 2019 Jan 15.
3 Impact of Mon2 monocyte-platelet aggregates on human coronary artery disease.Eur J Clin Invest. 2018 May;48(5):e12911. doi: 10.1111/eci.12911. Epub 2018 Mar 7.
4 Leishmania donovani causing cutaneous leishmaniasis in Sri Lanka: a wolf in sheep's clothing?.Trends Parasitol. 2009 Oct;25(10):458-63. doi: 10.1016/j.pt.2009.07.002. Epub 2009 Sep 4.
5 DNA helicase activity in Werner's syndrome gene product synthesized in a baculovirus system.Nucleic Acids Res. 1997 Aug 1;25(15):2973-8. doi: 10.1093/nar/25.15.2973.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
8 Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
9 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
10 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
11 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
12 Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
13 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
16 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
19 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.