Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEC13I5)

• DOT Name: Fructose-bisphosphate aldolase C (ALDOC)
• Synonyms: EC 4.1.2.13; Brain-type aldolase
• Gene Name: ALDOC
• Related Disease:
  Hepatocellular carcinoma
  Liver cancer
  Schizophrenia
  Neuroblastoma
• UniProt ID: ALDOC_HUMAN
• PDB ID: 1XFB
• EC Number: 4.1.2.13
• Pfam ID: PF00274
• Sequence:
  MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
  QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTD
  GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQ
  NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
  PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTF
  SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIA
  NHAY
• KEGG Pathway:
  Glycolysis / Gluconeogenesis (hsa00010)
  Pentose phosphate pathway (hsa00030)
  Fructose and mannose metabolism (hsa00051)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
  HIF-1 sig.ling pathway (hsa04066)
• Reactome Pathway:
  Glycolysis (R-HSA-70171)
  Gluconeogenesis (R-HSA-70263)
  Neutrophil degranulation (R-HSA-6798695)
• BioCyc Pathway: MetaCyc:HS03200-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Liver cancer	DISDE4BI	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[2]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[3]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Fructose-bisphosphate aldolase C (ALDOC) affects the response to substance of Etoposide.	[35]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Fructose-bisphosphate aldolase C (ALDOC).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fructose-bisphosphate aldolase C (ALDOC).	[28]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Fructose-bisphosphate aldolase C (ALDOC).	[30]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[9]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[12]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[13]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[15]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[17]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[18]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[19]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[20]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[21]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[22]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[23]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[24]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[25]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[26]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[29]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[31]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[33]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of Fructose-bisphosphate aldolase C (ALDOC).	[34]

References

• [1] Molecular cloning and expression of rat aldolase C messenger RNA during development and hepatocarcinogenesis.Eur J Biochem. 1987 Mar 16;163(3):513-8. doi: 10.1111/j.1432-1033.1987.tb10898.x.
• [2] Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.J Neural Transm (Vienna). 2009 Mar;116(3):275-89. doi: 10.1007/s00702-008-0156-y. Epub 2008 Nov 26.
• [3] The transcription of the human fructose-bisphosphate aldolase C gene is activated by nerve-growth-factor-induced B factor in human neuroblastoma cells.Biochem J. 1997 Apr 1;323 ( Pt 1)(Pt 1):245-50. doi: 10.1042/bj3230245.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [7] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [8] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [9] Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [13] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [14] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [15] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [16] Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
• [17] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [18] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [19] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [20] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [21] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [22] A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
• [23] Resveratrol-induced cell growth inhibition and apoptosis is associated with modulation of phosphoglycerate mutase B in human prostate cancer cells: two-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis and mass spectrometry evaluation. Cancer Detect Prev. 2004;28(6):443-52. doi: 10.1016/j.cdp.2004.08.009.
• [24] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [25] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [26] Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
• [27] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [28] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [29] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [30] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [31] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [32] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [33] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [34] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [35] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.