Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF6C65Q)

DOT Name Dynein axonemal intermediate chain 1 (DNAI1)
Synonyms Axonemal dynein intermediate chain 1
Gene Name DNAI1
Related Disease
Primary ciliary dyskinesia 1 ( )
Scleroderma ( )
Systemic sclerosis ( )
Advanced cancer ( )
Bronchiectasis ( )
Cystic fibrosis ( )
Fleck corneal dystrophy ( )
Hydrocephalus ( )
Inflammatory bowel disease ( )
Myelodysplastic syndrome ( )
Myocardial infarction ( )
Neoplasm ( )
Pancreatic cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Urinary tract infection ( )
Castration-resistant prostate carcinoma ( )
Male infertility ( )
Primary ciliary dyskinesia ( )
Asthma ( )
Venous thromboembolism ( )
UniProt ID
DNAI1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8J07
Pfam ID
PF00400
Sequence
MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDA
ELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRR
QHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTP
KQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEK
QEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQ
DFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQ
SRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQP
SFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKV
EGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHN
MSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAA
VTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSP
NLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKT
Function Part of the dynein complex of respiratory cilia.
Tissue Specificity Expressed in respiratory ciliated cells (at protein level).
KEGG Pathway
Motor proteins (hsa04814 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Primary ciliary dyskinesia 1 DISPGX6H Definitive Autosomal recessive [1]
Scleroderma DISVQ342 Definitive Biomarker [2]
Systemic sclerosis DISF44L6 Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Genetic Variation [3]
Bronchiectasis DIS5MYEE Strong Biomarker [4]
Cystic fibrosis DIS2OK1Q Strong Biomarker [5]
Fleck corneal dystrophy DISERQJ1 Strong Biomarker [6]
Hydrocephalus DISIZUF7 Strong Biomarker [7]
Inflammatory bowel disease DISGN23E Strong Biomarker [8]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [9]
Myocardial infarction DIS655KI Strong Biomarker [10]
Neoplasm DISZKGEW Strong Biomarker [11]
Pancreatic cancer DISJC981 Strong Biomarker [12]
Prostate cancer DISF190Y Strong Biomarker [13]
Prostate carcinoma DISMJPLE Strong Biomarker [13]
Urinary tract infection DISMT6UV Strong Biomarker [14]
Castration-resistant prostate carcinoma DISVGAE6 moderate Biomarker [15]
Male infertility DISY3YZZ moderate Biomarker [16]
Primary ciliary dyskinesia DISOBC7V Supportive Autosomal dominant [17]
Asthma DISW9QNS Limited Biomarker [18]
Venous thromboembolism DISUR7CR Limited Biomarker [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Testosterone DM7HUNW Approved Testosterone decreases the expression of Dynein axonemal intermediate chain 1 (DNAI1). [20]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Dynein axonemal intermediate chain 1 (DNAI1). [21]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Chromosome changes in lymphocytes of patients with scleroderma.Ann Genet. 1995;38(3):145-50.
3 Predictors of post-cancer diagnosis resignation among Japanese cancer survivors.J Cancer Surviv. 2020 Apr;14(2):106-113. doi: 10.1007/s11764-019-00827-0. Epub 2019 Nov 13.
4 Predicting factors for chronic colonization of Pseudomonas aeruginosa in bronchiectasis.Eur J Clin Microbiol Infect Dis. 2019 Dec;38(12):2299-2304. doi: 10.1007/s10096-019-03675-z. Epub 2019 Aug 31.
5 Ciliated conical epithelial cell protrusions point towards a diagnosis of primary ciliary dyskinesia.Respir Res. 2018 Jun 25;19(1):125. doi: 10.1186/s12931-018-0782-3.
6 Age-Dependent Subchondral Bone Remodeling and Cartilage Repair in a Minipig Defect Model.Tissue Eng Part C Methods. 2017 Nov;23(11):745-753. doi: 10.1089/ten.TEC.2017.0109. Epub 2017 Oct 27.
7 Cilia-related diseases.J Pathol. 2004 Nov;204(4):470-7. doi: 10.1002/path.1652.
8 Resources used in the treatment of perianal Crohn's disease and the results in a real-life cohort.Gastroenterol Hepatol. 2018 Jun-Jul;41(6):353-361. doi: 10.1016/j.gastrohep.2018.04.006. Epub 2018 May 11.
9 Myelodysplastic syndrome with hypereosinophilia and a nonrandom chromosomal abnormality dic(1;7): confirmation of eosinophil clonal involvement by fluorescence in situ hybridization.Cancer Genet Cytogenet. 1998 Nov;107(1):65-8. doi: 10.1016/s0165-4608(98)00055-7.
10 Generation of Induced Cardiospheres via Reprogramming of Skin Fibroblasts for Myocardial Regeneration.Stem Cells. 2016 Nov;34(11):2693-2706. doi: 10.1002/stem.2438. Epub 2016 Jul 7.
11 Genetic alterations and tumor immune attack in Yo paraneoplastic cerebellar degeneration.Acta Neuropathol. 2018 Apr;135(4):569-579. doi: 10.1007/s00401-017-1802-y. Epub 2018 Jan 3.
12 Pancreatic Cancer Database: an integrative resource for pancreatic cancer.Cancer Biol Ther. 2014 Aug;15(8):963-7. doi: 10.4161/cbt.29188. Epub 2014 May 19.
13 High Norwegian prostate cancer mortality: evidence of over-reporting.Scand J Urol. 2018 Apr;52(2):122-128. doi: 10.1080/21681805.2017.1421260. Epub 2018 Jan 11.
14 Is there a conflict between general practitioners applying guidelines for antibiotic prescribing and including their patients' preferences?.Patient Prefer Adherence. 2017 Dec 21;12:9-19. doi: 10.2147/PPA.S147616. eCollection 2018.
15 Rare sugar D-allose induces programmed cell death in hormone refractory prostate cancer cells.Apoptosis. 2008 Sep;13(9):1121-34. doi: 10.1007/s10495-008-0232-7.
16 Sperm defects in primary ciliary dyskinesia and related causes of male infertility.Cell Mol Life Sci. 2020 Jun;77(11):2029-2048. doi: 10.1007/s00018-019-03389-7. Epub 2019 Nov 28.
17 Primary Ciliary Dyskinesia. 2007 Jan 24 [updated 2019 Dec 5]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
18 Ventilation Inhomogeneity and Bronchial Basement Membrane Changes in Chronic Neutrophilic Airway Inflammation.Chest. 2020 Apr;157(4):779-789. doi: 10.1016/j.chest.2019.10.023. Epub 2019 Nov 9.
19 Clinical and laboratory characteristics of children with venous thromboembolism and protein C-deficiency: an observational Israeli-German cohort study.Br J Haematol. 2014 Nov;167(3):385-93. doi: 10.1111/bjh.13039. Epub 2014 Jul 18.
20 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
21 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.