Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFPFMT8)

• DOT Name: DNA fragmentation factor subunit alpha (DFFA)
• Synonyms: DNA fragmentation factor 45 kDa subunit; DFF-45; Inhibitor of CAD; ICAD
• Gene Name: DFFA
• UniProt ID: DFFA_HUMAN
• PDB ID: 1IBX; 1IYR; 1KOY
• Pfam ID: PF02017 ; PF09033
• Sequence:
  MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
  LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
  GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
  QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
  ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
  QSLHSLRSISASKASPPGDLQNPKRARQDPT
• Function: Inhibitor of the caspase-activated DNase (DFF40).
• KEGG Pathway: Apoptosis (hsa04210)
• Reactome Pathway: Apoptosis induced DNA fragmentation (R-HSA-140342)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of DNA fragmentation factor subunit alpha (DFFA).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of DNA fragmentation factor subunit alpha (DFFA).	[21]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of DNA fragmentation factor subunit alpha (DFFA).	[23]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of DNA fragmentation factor subunit alpha (DFFA).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DNA fragmentation factor subunit alpha (DFFA).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of DNA fragmentation factor subunit alpha (DFFA).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[13]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[14]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[15]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of DNA fragmentation factor subunit alpha (DFFA).	[12]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[16]
Menthol	DMG2KW7	Approved	Menthol increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[17]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[18]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[19]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of DNA fragmentation factor subunit alpha (DFFA).	[20]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[25]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of DNA fragmentation factor subunit alpha (DFFA).	[26]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[27]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[28]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID decreases the expression of DNA fragmentation factor subunit alpha (DFFA).	[19]

4 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the degradation of DNA fragmentation factor subunit alpha (DFFA).	[5]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the degradation of DNA fragmentation factor subunit alpha (DFFA).	[5]
Aclarubicin	DMLFZHD	Approved	Aclarubicin increases the degradation of DNA fragmentation factor subunit alpha (DFFA).	[5]
EMBELIN	DMFZO4Y	Terminated	EMBELIN increases the cleavage of DNA fragmentation factor subunit alpha (DFFA).	[24]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Comparison of anthracycline-induced death of human leukemia cells: programmed cell death versus necrosis. Apoptosis. 2002 Dec;7(6):537-48. doi: 10.1023/a:1020647211557.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [12] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [13] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [14] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [15] Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
• [16] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [17] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [18] [Mechanisms of capsaicin-induced apoptosis of human melanoma A375-S2 cells]. Zhonghua Zhong Liu Za Zhi. 2005 Jul;27(7):401-3.
• [19] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [20] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [21] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [22] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [23] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [24] XIAP inhibitor embelin induces autophagic and apoptotic cell death in human oral squamous cell carcinoma cells. Environ Toxicol. 2017 Nov;32(11):2371-2378. doi: 10.1002/tox.22450. Epub 2017 Jul 19.
• [25] Effect of bisphenol-A on the expression of selected genes involved in cell cycle and apoptosis in the OVCAR-3 cell line. Toxicol Lett. 2011 Apr 10;202(1):30-5. doi: 10.1016/j.toxlet.2011.01.015. Epub 2011 Jan 26.
• [26] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [27] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [28] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.