Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG4BDF3)

• DOT Name: NGFI-A-binding protein 2 (NAB2)
• Synonyms: EGR-1-binding protein 2; Melanoma-associated delayed early response protein; Protein MADER
• Gene Name: NAB2
• Related Disease:
  Intellectual disability
  Prostate cancer
  Advanced cancer
  Burkitt lymphoma
  Dedifferentiated liposarcoma
  Head-neck squamous cell carcinoma
  Liposarcoma
  Lung cancer
  Lung carcinoma
  Prostate neoplasm
  Squamous cell carcinoma
  Acute myelogenous leukaemia
  Adult glioblastoma
  Glioblastoma multiforme
  Metastatic malignant neoplasm
  Hereditary chronic pancreatitis
  Neuropathy, congenital hypomelinating
  Prostate carcinoma
  Schizophrenia
  Type-1/2 diabetes
• UniProt ID: NAB2_HUMAN
• Pfam ID: PF04904 ; PF04905
• Sequence:
  MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYET
  FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAV
  PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
  DPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPE
  MVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI
  IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
  KGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL
  DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
  CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
• Function: Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability.
• Tissue Specificity: Widely expressed at low levels. Highly expressed in melanoma cell lines.
• Reactome Pathway:
  EGR2 and SOX10-mediated initiation of Schwann cell myelination (R-HSA-9619665)
  NGF-stimulated transcription (R-HSA-9031628)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Intellectual disability	DISMBNXP	Definitive	Genetic Variation	[1]
Prostate cancer	DISF190Y	Definitive	Posttranslational Modification	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[4]
Dedifferentiated liposarcoma	DISYJUCJ	Strong	Genetic Variation	[5]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[3]
Liposarcoma	DIS8IZVM	Strong	Biomarker	[6]
Lung cancer	DISCM4YA	Strong	Posttranslational Modification	[7]
Lung carcinoma	DISTR26C	Strong	Posttranslational Modification	[7]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[8]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[9]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[10]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[11]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[11]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[12]
Hereditary chronic pancreatitis	DISF0J1Q	Disputed	Genetic Variation	[13]
Neuropathy, congenital hypomelinating	DISZUW4L	Limited	Biomarker	[14]
Prostate carcinoma	DISMJPLE	Limited	Posttranslational Modification	[2]
Schizophrenia	DISSRV2N	Limited	Genetic Variation	[15]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[16]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of NGFI-A-binding protein 2 (NAB2).	[17]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of NGFI-A-binding protein 2 (NAB2).	[18]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of NGFI-A-binding protein 2 (NAB2).	[19]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of NGFI-A-binding protein 2 (NAB2).	[20]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of NGFI-A-binding protein 2 (NAB2).	[21]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of NGFI-A-binding protein 2 (NAB2).	[22]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of NGFI-A-binding protein 2 (NAB2).	[23]
Marinol	DM70IK5	Approved	Marinol decreases the expression of NGFI-A-binding protein 2 (NAB2).	[24]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of NGFI-A-binding protein 2 (NAB2).	[25]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of NGFI-A-binding protein 2 (NAB2).	[26]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of NGFI-A-binding protein 2 (NAB2).	[27]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of NGFI-A-binding protein 2 (NAB2).	[28]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of NGFI-A-binding protein 2 (NAB2).	[20]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of NGFI-A-binding protein 2 (NAB2).	[29]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of NGFI-A-binding protein 2 (NAB2).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of NGFI-A-binding protein 2 (NAB2).	[31]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of NGFI-A-binding protein 2 (NAB2).	[33]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of NGFI-A-binding protein 2 (NAB2).	[32]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of NGFI-A-binding protein 2 (NAB2).	[32]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	1,6-hexamethylene diisocyanate increases the methylation of NGFI-A-binding protein 2 (NAB2).	[34]

References

• [1] Structure-function relationships in the Nab2 polyadenosine-RNA binding Zn finger protein family.Protein Sci. 2019 Mar;28(3):513-523. doi: 10.1002/pro.3565. Epub 2019 Jan 16.
• [2] Prognostic value of CpG island hypermethylation at PTGS2, RAR-beta, EDNRB, and other gene loci in patients undergoing radical prostatectomy.Eur Urol. 2007 Mar;51(3):665-74; discussion 674. doi: 10.1016/j.eururo.2006.08.008. Epub 2006 Aug 23.
• [3] NGFI-A Binding Protein 2 Promotes EGF-Dependent HNSCC Cell Invasion.Cancers (Basel). 2019 Mar 6;11(3):315. doi: 10.3390/cancers11030315.
• [4] A Burkitt lymphoma cell line with integrated Epstein-Barr virus at a stable chromosome modification site.Virology. 1993 Jul;195(1):248-51. doi: 10.1006/viro.1993.1367.
• [5] Nuclear relocation of STAT6 reliably predicts NAB2-STAT6 fusion for the diagnosis of solitary fibrous tumour.Histopathology. 2014 Nov;65(5):613-22. doi: 10.1111/his.12431. Epub 2014 Sep 2.
• [6] NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.Mol Cell Biol. 1996 Jul;16(7):3545-53. doi: 10.1128/MCB.16.7.3545.
• [7] Early growth response-1 induces and enhances vascular endothelial growth factor-A expression in lung cancer cells.Am J Pathol. 2010 Jul;177(1):70-83. doi: 10.2353/ajpath.2010.091164. Epub 2010 May 20.
• [8] Frequent and early loss of the EGR1 corepressor NAB2 in human prostate carcinoma.Hum Pathol. 2001 Sep;32(9):935-9. doi: 10.1053/hupa.2001.27102.
• [9] Down-regulation of insulin-like growth factor binding protein-5 (IGFBP-5): novel marker for cervical carcinogenesis.Int J Cancer. 2007 May 15;120(10):2068-77. doi: 10.1002/ijc.22264.
• [10] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [11] Case Report: Next generation sequencing identifies a NAB2-STAT6 fusion in Glioblastoma.Diagn Pathol. 2016 Jan 27;11:13. doi: 10.1186/s13000-016-0455-9.
• [12] NAB2-STAT6 fusion gene analysis in two cases of meningeal solitary fibrous tumor/hemangiopericytoma with late distant metastases.Brain Tumor Pathol. 2015 Oct;32(4):268-74. doi: 10.1007/s10014-015-0220-x. Epub 2015 Apr 18.
• [13] Grading of meningeal solitary fibrous tumors/hemangiopericytomas: analysis of the prognostic value of the Marseille Grading System in a cohort of 132 patients.Brain Pathol. 2019 Jan;29(1):18-27. doi: 10.1111/bpa.12613. Epub 2018 May 7.
• [14] Nab proteins are essential for peripheral nervous system myelination.Nat Neurosci. 2005 Jul;8(7):932-40. doi: 10.1038/nn1490.
• [15] Genome-wide association study of schizophrenia in Ashkenazi Jews.Am J Med Genet B Neuropsychiatr Genet. 2015 Dec;168(8):649-59. doi: 10.1002/ajmg.b.32349. Epub 2015 Jul 21.
• [16] Hyperglycemia induced early growth response-1 regulates vascular dysfunction in human retinal endothelial cells.Microvasc Res. 2018 May;117:37-43. doi: 10.1016/j.mvr.2018.01.002. Epub 2018 Jan 4.
• [17] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [18] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [19] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [20] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [21] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [22] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [23] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [24] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [25] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [26] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [27] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [28] Effects of Imatinib Mesylate (Gleevec) on human islet NF-kappaB activation and chemokine production in vitro. PLoS One. 2011;6(9):e24831. doi: 10.1371/journal.pone.0024831. Epub 2011 Sep 14.
• [29] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [30] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [33] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [34] DNA methylation modifies urine biomarker levels in 1,6-hexamethylene diisocyanate exposed workers: a pilot study. Toxicol Lett. 2014 Dec 1;231(2):217-26. doi: 10.1016/j.toxlet.2014.10.024. Epub 2014 Oct 22.