Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHXEK3E)

DOT Name Actin-binding LIM protein 1 (ABLIM1)
Synonyms abLIM-1; Actin-binding LIM protein family member 1; Actin-binding double zinc finger protein; LIMAB1; Limatin
Gene Name ABLIM1
Related Disease
Drug dependence ( )
Substance abuse ( )
Substance dependence ( )
Alcohol dependence ( )
Adrenal adenoma ( )
UniProt ID
ABLM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16182 ; PF00412 ; PF02209
Sequence
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHL
LYLCPKDYCPRGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRP
GSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRP
GNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKS
SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRR
QLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYG
RNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEM
LMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
Function May act as scaffold protein. May play a role in the development of the retina. Has been suggested to play a role in axon guidance.
Tissue Specificity Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers.
KEGG Pathway
Axon guidance (hsa04360 )
Reactome Pathway
DCC mediated attractive signaling (R-HSA-418885 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Drug dependence DIS9IXRC Strong Biomarker [1]
Substance abuse DIS327VW Strong Biomarker [1]
Substance dependence DISDRAAR Strong Biomarker [1]
Alcohol dependence DIS4ZSCO moderate Genetic Variation [2]
Adrenal adenoma DISC2UN8 Limited Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Mitomycin DMH0ZJE Approved Actin-binding LIM protein 1 (ABLIM1) affects the response to substance of Mitomycin. [23]
Vinblastine DM5TVS3 Approved Actin-binding LIM protein 1 (ABLIM1) affects the response to substance of Vinblastine. [23]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [8]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Actin-binding LIM protein 1 (ABLIM1). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Actin-binding LIM protein 1 (ABLIM1). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Actin-binding LIM protein 1 (ABLIM1). [12]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Actin-binding LIM protein 1 (ABLIM1). [13]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [14]
Progesterone DMUY35B Approved Progesterone increases the expression of Actin-binding LIM protein 1 (ABLIM1). [15]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Actin-binding LIM protein 1 (ABLIM1). [16]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Actin-binding LIM protein 1 (ABLIM1). [17]
Seocalcitol DMKL9QO Phase 3 Seocalcitol increases the expression of Actin-binding LIM protein 1 (ABLIM1). [18]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Actin-binding LIM protein 1 (ABLIM1). [19]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Actin-binding LIM protein 1 (ABLIM1). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Actin-binding LIM protein 1 (ABLIM1). [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Quercetin DM3NC4M Approved Quercetin increases the phosphorylation of Actin-binding LIM protein 1 (ABLIM1). [10]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Actin-binding LIM protein 1 (ABLIM1). [21]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Actin-binding LIM protein 1 (ABLIM1). [10]
Coumarin DM0N8ZM Investigative Coumarin affects the phosphorylation of Actin-binding LIM protein 1 (ABLIM1). [10]
------------------------------------------------------------------------------------

References

1 Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
2 Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.J Mol Neurosci. 2012 Feb;46(2):265-71. doi: 10.1007/s12031-011-9530-6. Epub 2011 May 6.
3 Microarray gene expression and immunohistochemistry analyses of adrenocortical tumors identify IGF2 and Ki-67 as useful in differentiating carcinomas from adenomas.Endocr Relat Cancer. 2009 Jun;16(2):573-83. doi: 10.1677/ERC-08-0237. Epub 2009 Feb 13.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
9 Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
10 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
13 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
14 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
15 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
16 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
17 Differential expression of genes induced by resveratrol in LNCaP cells: P53-mediated molecular targets. Int J Cancer. 2003 Mar 20;104(2):204-12.
18 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
19 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
20 BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
21 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
22 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
23 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.