General Information of Drug Off-Target (DOT) (ID: OTJXYAE5)

DOT Name Ankyrin repeat domain-containing protein 30A (ANKRD30A)
Synonyms Serologically defined breast cancer antigen NY-BR-1
Gene Name ANKRD30A
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Metastatic malignant neoplasm ( )
Neoplasm ( )
Prostate neoplasm ( )
Ankylosing spondylitis ( )
Autoimmune disease ( )
Autoimmune disease, susceptibility to, 6 ( )
Autoimmune thyroid disease ( )
Coeliac disease ( )
Common variable immunodeficiency ( )
Crohn disease ( )
Juvenile idiopathic arthritis ( )
Psoriasis ( )
STAT3-related early-onset multisystem autoimmune disease ( )
Systemic lupus erythematosus ( )
Type-1 diabetes ( )
Ulcerative colitis ( )
Epithelial ovarian cancer ( )
Breast neoplasm ( )
Invasive breast carcinoma ( )
Male breast carcinoma ( )
UniProt ID
AN30A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6R2L
Pfam ID
PF12796 ; PF14915
Sequence
MEEISAAAVKVVPGPERPSPFSQLVYTSNDSYIVHSGDLRKIHKAASRGQVRKLEKMTKR
KKTINLNIQDAQKRTALHWACVNGHEEVVTFLVDRKCQLDVLDGEHRTPLMKALQCHQEA
CANILIDSGADINLVDVYGNTALHYAVYSEILSVVAKLLSHGAVIEVHNKASLTPLLLSI
TKRSEQIVEFLLIKNANANAVNKYKCTALMLAVCHGSSEIVGMLLQQNVDVFAADICGVT
AEHYAVTCGFHHIHEQIMEYIRKLSKNHQNTNPEGTSAGTPDEAAPLAERTPDTAESLVE
KTPDEAAPLVERTPDTAESLVEKTPDEAASLVEGTSDKIQCLEKATSGKFEQSAEETPRE
ITSPAKETSEKFTWPAKGRPRKIAWEKKEDTPREIMSPAKETSEKFTWAAKGRPRKIAWE
KKETPVKTGCVARVTSNKTKVLEKGRSKMIACPTKESSTKASANDQRFPSESKQEEDEEY
SCDSRSLFESSAKIQVCIPESIYQKVMEINREVEEPPKKPSAFKPAIEMQNSVPNKAFEL
KNEQTLRADPMFPPESKQKDYEENSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEE
SPNKDGLLKATCGMKVSIPTKALELKDMQTFKAEPPGKPSAFEPATEMQKSVPNKALELK
NEQTLRADEILPSESKQKDYEENSWDTESLCETVSQKDVCLPKAAHQKEIDKINGKLEGS
PVKDGLLKANCGMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKN
EQTLRADEILPSESKQKDYEESSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEESP
DNDGFLKAPCRMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNE
QTLRADQMFPSESKQKKVEENSWDSESLRETVSQKDVCVPKATHQKEMDKISGKLEDSTS
LSKILDTVHSCERARELQKDHCEQRTGKMEQMKKKFCVLKKKLSEAKEIKSQLENQKVKW
EQELCSVRLTLNQEEEKRRNADILNEKIREELGRIEEQHRKELEVKQQLEQALRIQDIEL
KSVESNLNQVSHTHENENYLLHENCMLKKEIAMLKLEIATLKHQYQEKENKYFEDIKILK
EKNAELQMTLKLKEESLTKRASQYSGQLKVLIAENTMLTSKLKEKQDKEILEAEIESHHP
RLASAVQDHDQIVTSRKSQEPAFHIAGDACLQRKMNVDVSSTIYNNEVLHQPLSEAQRKS
KSLKINLNYAGDALRENTLVSEHAQRDQRETQCQMKEAEHMYQNEQDNVNKHTEQQESLD
QKLFQLQSKNMWLQQQLVHAHKKADNKSKITIDIHFLERKMQHHLLKEKNEEIFNYNNHL
KNRIYQYEKEKAETENS
Tissue Specificity Mainly expressed in breast and testis. A very faint signal is detected in placenta. Also expressed in many breast cancer cells.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Carcinoma DISH9F1N Strong Biomarker [3]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [4]
Neoplasm DISZKGEW Strong Biomarker [2]
Prostate neoplasm DISHDKGQ Strong Altered Expression [5]
Ankylosing spondylitis DISRC6IR moderate Genetic Variation [6]
Autoimmune disease DISORMTM moderate Genetic Variation [6]
Autoimmune disease, susceptibility to, 6 DISHNUXI moderate Genetic Variation [6]
Autoimmune thyroid disease DISIHC6A moderate Genetic Variation [6]
Coeliac disease DISIY60C moderate Genetic Variation [6]
Common variable immunodeficiency DISHE7JQ moderate Genetic Variation [6]
Crohn disease DIS2C5Q8 moderate Genetic Variation [6]
Juvenile idiopathic arthritis DISQZGBV moderate Genetic Variation [6]
Psoriasis DIS59VMN moderate Genetic Variation [6]
STAT3-related early-onset multisystem autoimmune disease DISAXTN7 moderate Genetic Variation [6]
Systemic lupus erythematosus DISI1SZ7 moderate Genetic Variation [6]
Type-1 diabetes DIS7HLUB moderate Genetic Variation [6]
Ulcerative colitis DIS8K27O moderate Genetic Variation [6]
Epithelial ovarian cancer DIS56MH2 Disputed Genetic Variation [7]
Breast neoplasm DISNGJLM Limited Altered Expression [8]
Invasive breast carcinoma DISANYTW Limited Biomarker [9]
Male breast carcinoma DISUNQ2Q Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [13]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [11]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [12]
PIRINIXIC ACID DM82Y75 Preclinical PIRINIXIC ACID decreases the expression of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Ankyrin repeat domain-containing protein 30A (ANKRD30A). [12]
------------------------------------------------------------------------------------

References

1 Distinct expression patterns of the immunogenic differentiation antigen NY-BR-1 in normal breast, testis and their malignant counterparts.Int J Cancer. 2008 Apr 1;122(7):1585-91. doi: 10.1002/ijc.23241.
2 A transplantable tumor model allowing investigation of NY-BR-1-specific T cell responses in HLA-DRB1*0401 transgenic mice.BMC Cancer. 2019 Sep 13;19(1):914. doi: 10.1186/s12885-019-6102-6.
3 Immunohistochemical Analysis of the Expression of Breast Markers in Basal-like Breast Carcinomas Defined as Triple Negative Cancers Expressing Keratin 5.Pathol Oncol Res. 2018 Apr;24(2):259-267. doi: 10.1007/s12253-017-0246-y. Epub 2017 May 3.
4 Preferential expression of NY-BR-1 and GATA-3 in male breast cancer.J Cancer Res Clin Oncol. 2018 Feb;144(2):199-204. doi: 10.1007/s00432-017-2542-z. Epub 2017 Nov 7.
5 Humoral and cellular immune responses against the breast cancer antigen NY-BR-1: definition of two HLA-A2 restricted peptide epitopes.Cancer Immun. 2005 Dec 12;5:11.
6 Meta-analysis of shared genetic architecture across ten pediatric autoimmune diseases.Nat Med. 2015 Sep;21(9):1018-27. doi: 10.1038/nm.3933. Epub 2015 Aug 24.
7 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.Nat Commun. 2014 Aug 19;5:4682. doi: 10.1038/ncomms5682.
8 In silico SNP analysis of the breast cancer antigen NY-BR-1.BMC Cancer. 2016 Nov 18;16(1):901. doi: 10.1186/s12885-016-2924-7.
9 Preferential nuclear and cytoplasmic NY-BR-1 protein expression in primary breast cancer and lymph node metastases.Clin Cancer Res. 2006 May 1;12(9):2745-51. doi: 10.1158/1078-0432.CCR-05-2192.
10 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
11 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
12 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 Immunoselection and characterization of a human genomic PPAR binding fragment located within POTE genes. Biochimie. 2007 Mar;89(3):329-36. doi: 10.1016/j.biochi.2006.09.017. Epub 2006 Oct 18.