Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK639ET)

DOT Name Tudor domain-containing protein 7 (TDRD7)
Synonyms PCTAIRE2-binding protein; Tudor repeat associator with PCTAIRE-2; Trap
Gene Name TDRD7
Related Disease
Cataract 20 multiple types ( )
Male infertility ( )
Azoospermia ( )
Cataract 36 ( )
Glaucoma/ocular hypertension ( )
Influenza ( )
Neoplasm ( )
Cataract ( )
UniProt ID
TDRD7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3RCO
Pfam ID
PF12872 ; PF00567
Sequence
MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVV
RIETSRSGEITCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPK
ATLRQPGFASNFSVGKKPNPAPLRDKGNSVGVKPDAEMSPYMLHTTLGNEAFKDIPVQRH
VTMSTNNRFSPKASLQPPLQMHLSRTSTKEMSDNLNQTVEKPNVKPPASYTYKMDEVQNR
IKEILNKHNNGIWISKLPHFYKELYKEDLNQGILQQFEHWPHICTVEKPCSGGQDLLLYP
AKRKQLLRSELDTEKVPLSPLPGPKQTPPLKGCPTVMAGDFKEKVADLLVKYTSGLWASA
LPKAFEEMYKVKFPEDALKNLASLSDVCSIDYISGNPQKAILYAKLPLPTDKIQKDAGQA
HGDNDIKAMVEQEYLQVEESIAESANTFMEDITVPPLMIPTEASPSVLVVELSNTNEVVI
RYVGKDYSAAQELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDAWLRAQVISTEEN
KIKVCYVDYGFSENVEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTC
GKIFAVEILDKADIPLVVLYDTSGEDDININATCLKAICDKSLEVHLQVDAMYTNVKVTN
ICSDGTLYCQVPCKGLNKLSDLLRKIEDYFHCKHMTSECFVSLPFCGKICLFHCKGKWLR
VEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEMIAIPPQAIKCCLADLPQSI
GMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNAD
LWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEE
LPPPVHLSKPGEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVE
KDQVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAV
TAQLAGVKCNQWSEEASMVFRNHVEKKPLVALVQTVIENANPWDRKVVVYLVDTSLPDTD
TWIHDFMSEYLIELSKVN
Function
Component of specific cytoplasmic RNA granules involved in post-transcriptional regulation of specific genes: probably acts by binding to specific mRNAs and regulating their translation. Required for lens transparency during lens development, by regulating translation of genes such as CRYBB3 and HSPB1 in the developing lens. Also required during spermatogenesis.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cataract 20 multiple types DISN0IHS Definitive Biomarker [1]
Male infertility DISY3YZZ Definitive Biomarker [1]
Azoospermia DIS94181 Strong Biomarker [2]
Cataract 36 DISDMMM9 Strong Autosomal recessive [1]
Glaucoma/ocular hypertension DISLBXBY Strong Biomarker [1]
Influenza DIS3PNU3 Strong Biomarker [3]
Neoplasm DISZKGEW Strong Biomarker [4]
Cataract DISUD7SL moderate Biomarker [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Tudor domain-containing protein 7 (TDRD7). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Tudor domain-containing protein 7 (TDRD7). [6]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Tudor domain-containing protein 7 (TDRD7). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Tudor domain-containing protein 7 (TDRD7). [8]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Tudor domain-containing protein 7 (TDRD7). [9]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Tudor domain-containing protein 7 (TDRD7). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Tudor domain-containing protein 7 (TDRD7). [11]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Tudor domain-containing protein 7 (TDRD7). [12]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Tudor domain-containing protein 7 (TDRD7). [13]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Tudor domain-containing protein 7 (TDRD7). [14]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Tudor domain-containing protein 7 (TDRD7). [9]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Tudor domain-containing protein 7 (TDRD7). [14]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Tudor domain-containing protein 7 (TDRD7). [15]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Tudor domain-containing protein 7 (TDRD7). [13]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Tudor domain-containing protein 7 (TDRD7). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Tudor domain-containing protein 7 (TDRD7). [16]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Tudor domain-containing protein 7 (TDRD7). [17]
------------------------------------------------------------------------------------

References

1 Mutations in the RNA granule component TDRD7 cause cataract and glaucoma. Science. 2011 Mar 25;331(6024):1571-6. doi: 10.1126/science.1195970.
2 Loss-of-function mutations in TDRD7 lead to a rare novel syndrome combining congenital cataract and nonobstructive azoospermia in humans.Genet Med. 2019 May;21(5):1209-1217. doi: 10.1038/gim.2017.130. Epub 2017 Aug 24.
3 A host transcriptional signature for presymptomatic detection of infection in humans exposed to influenza H1N1 or H3N2.PLoS One. 2013;8(1):e52198. doi: 10.1371/journal.pone.0052198. Epub 2013 Jan 9.
4 In Vivo Characterization of 4 (68)Ga-Labeled Multimeric RGD Peptides to Image (v)(3) Integrin Expression in 2 Human Tumor Xenograft Mouse Models.J Nucl Med. 2018 Aug;59(8):1296-1301. doi: 10.2967/jnumed.117.206979. Epub 2018 Apr 6.
5 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
6 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
7 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
12 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
13 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
14 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
15 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
18 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.