General Information of Drug Off-Target (DOT) (ID: OTO3TOEU)

DOT Name CREB/ATF bZIP transcription factor (CREBZF)
Synonyms Host cell factor-binding transcription factor Zhangfei; HCF-binding transcription factor Zhangfei
Gene Name CREBZF
Related Disease
Acute myocardial infarction ( )
Adenoma ( )
Adult lymphoma ( )
Breast cancer ( )
Breast carcinoma ( )
Cardiac failure ( )
Congestive heart failure ( )
Epilepsy ( )
Epithelial ovarian cancer ( )
Extranodal NK/T-cell Lymphoma ( )
Fatty liver disease ( )
Gastric cancer ( )
Leukopenia ( )
Lymphoma ( )
Medulloblastoma ( )
Myocardial infarction ( )
Myopia ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pediatric lymphoma ( )
Precancerous condition ( )
Stomach cancer ( )
Dental caries ( )
Keratoconjunctivitis sicca ( )
UniProt ID
ZHANG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00170
Sequence
MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDE
GELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHL
DPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSG
SAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLA
AENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSP
AGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Function
Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Tissue Specificity
In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myocardial infarction DISE3HTG Strong Biomarker [1]
Adenoma DIS78ZEV Strong Biomarker [2]
Adult lymphoma DISK8IZR Strong Genetic Variation [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Cardiac failure DISDC067 Strong Biomarker [5]
Congestive heart failure DIS32MEA Strong Biomarker [5]
Epilepsy DISBB28L Strong Biomarker [6]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [7]
Extranodal NK/T-cell Lymphoma DIS72GCL Strong Genetic Variation [8]
Fatty liver disease DIS485QZ Strong Altered Expression [9]
Gastric cancer DISXGOUK Strong Biomarker [2]
Leukopenia DISJMBMM Strong Biomarker [3]
Lymphoma DISN6V4S Strong Biomarker [10]
Medulloblastoma DISZD2ZL Strong Biomarker [11]
Myocardial infarction DIS655KI Strong Genetic Variation [12]
Myopia DISK5S60 Strong Biomarker [13]
Non-small-cell lung cancer DIS5Y6R9 Strong Genetic Variation [14]
Ovarian cancer DISZJHAP Strong Biomarker [7]
Ovarian neoplasm DISEAFTY Strong Biomarker [7]
Pediatric lymphoma DIS51BK2 Strong Genetic Variation [3]
Precancerous condition DISV06FL Strong Biomarker [2]
Stomach cancer DISKIJSX Strong Biomarker [2]
Dental caries DISRBCMD Limited Biomarker [15]
Keratoconjunctivitis sicca DISNOENH Limited Biomarker [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [17]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [18]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [19]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of CREB/ATF bZIP transcription factor (CREBZF). [20]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [21]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [22]
Coprexa DMA0WEK Phase 3 Coprexa increases the expression of CREB/ATF bZIP transcription factor (CREBZF). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [25]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [26]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of CREB/ATF bZIP transcription factor (CREBZF). [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of CREB/ATF bZIP transcription factor (CREBZF). [24]
------------------------------------------------------------------------------------

References

1 Cardioprotective role of zofenopril in hypertensive patients with acute myocardial infarction: a pooled individual data analysis of the SMILE studies.Blood Press. 2017 Aug;26(4):211-219. doi: 10.1080/08037051.2017.1281712. Epub 2017 Feb 3.
2 Potential miRNA-target interactions for the screening of gastric carcinoma development in gastric adenoma/dysplasia.Int J Med Sci. 2018 Mar 14;15(6):610-616. doi: 10.7150/ijms.24061. eCollection 2018.
3 Pretreatment EBV-DNA copy number is predictive of response and toxicities to SMILE chemotherapy for extranodal NK/T-cell lymphoma, nasal type.Clin Cancer Res. 2012 Aug 1;18(15):4183-90. doi: 10.1158/1078-0432.CCR-12-1064. Epub 2012 Jun 6.
4 Smartphone problem-solving and behavioural activation therapy to reduce fear of recurrence among patients with breast cancer (SMartphone Intervention to LEssen fear of cancer recurrence: SMILE project): protocol for a randomised controlled trial.BMJ Open. 2018 Nov 8;8(11):e024794. doi: 10.1136/bmjopen-2018-024794.
5 A Prospective, Multicenter, Post-Marketing Surveillance Study to Evaluate the Safety and Effectiveness of Tolvaptan in Patients with Reduced, Preserved, and Mid-Range Ejection Fraction Heart Failure.Int Heart J. 2019 Sep 27;60(5):1123-1130. doi: 10.1536/ihj.18-671. Epub 2019 Sep 4.
6 Self-Management education for adults with poorly controlled epILEpsy [SMILE (UK)]: a randomised controlled trial.Health Technol Assess. 2018 Apr;22(21):1-142. doi: 10.3310/hta22210.
7 Interaction between p53 and Ras signaling controls cisplatin resistance via HDAC4- and HIF-1-mediated regulation of apoptosis and autophagy.Theranostics. 2019 Jan 30;9(4):1096-1114. doi: 10.7150/thno.29673. eCollection 2019.
8 Defining the toxicity of current regimens for extranodal NK/T cell lymphoma: a systematic review and metaproportion.Expert Rev Anticancer Ther. 2019 Jan;19(1):93-104. doi: 10.1080/14737140.2019.1549992. Epub 2018 Nov 23.
9 Hepatic CREBZF couples insulin to lipogenesis by inhibiting insig activity and contributes to hepatic steatosis in diet-induced insulin-resistant mice.Hepatology. 2018 Oct;68(4):1361-1375. doi: 10.1002/hep.29926. Epub 2018 May 18.
10 Epstein-Barr virus-associated natural killer/T-cell lymphomas.Best Pract Res Clin Haematol. 2013 Mar;26(1):15-21. doi: 10.1016/j.beha.2013.04.002. Epub 2013 May 25.
11 Zhangfei induces the expression of the nerve growth factor receptor, trkA, in medulloblastoma cells and causes their differentiation or apoptosis.J Neurooncol. 2009 Jan;91(1):7-17. doi: 10.1007/s11060-008-9682-6. Epub 2008 Aug 22.
12 Efficacy and Safety of Zofenopril Versus Ramipril in the Treatment of Myocardial Infarction and Heart Failure: A Review of the Published and Unpublished Data of the Randomized Double-Blind SMILE-4 Study.Adv Ther. 2018 May;35(5):604-618. doi: 10.1007/s12325-018-0697-x. Epub 2018 Apr 17.
13 Surgical treatment of corneal dermoid by using intrastromal lenticule obtained from small-incision lenticule extraction.Int Ophthalmol. 2020 Jan;40(1):43-49. doi: 10.1007/s10792-019-01201-w. Epub 2019 Nov 17.
14 Factors associated with improvement in symptoms and quality of life for first-line EGFR-tyrosine kinase inhibitor treatment in patients with EGFR-mutated non-small-cell lung cancer - A multicenter prospective SMILE study.J Cancer. 2019 Jul 10;10(17):4151-4158. doi: 10.7150/jca.30507. eCollection 2019.
15 Development and Relative Validity of a Food Frequency Questionnaire to Assess Intakes of Total and Free Sugars in Australian Toddlers.Int J Environ Res Public Health. 2017 Nov 8;14(11):1361. doi: 10.3390/ijerph14111361.
16 Dry Eye After LASIK.Invest Ophthalmol Vis Sci. 2018 Nov 1;59(14):DES109-DES115. doi: 10.1167/iovs.17-23538.
17 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
18 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
19 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
20 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
21 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
22 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
23 Copper chelator ATN-224 inhibits endothelial function by multiple mechanisms. Microvasc Res. 2009 May;77(3):314-26.
24 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
25 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
26 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
27 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.