General Information of Drug Off-Target (DOT) (ID: OTQQMHM1)

DOT Name Translation initiation factor eIF2B subunit beta (EIF2B2)
Synonyms S20I15; S20III15; eIF2B GDP-GTP exchange factor subunit beta
Gene Name EIF2B2
Related Disease
Leishmaniasis ( )
Obsolete leukoencephalopathy with vanishing white matter ( )
Brain disease ( )
Breast cancer ( )
Breast carcinoma ( )
Cerebellar ataxia ( )
Diffuse systemic sclerosis ( )
Leukoencephalopathy with vanishing white matter 1 ( )
Neurodevelopmental disorder ( )
Scleroderma ( )
Systemic sclerosis ( )
Adrenocortical insufficiency ( )
Adrenoleukodystrophy ( )
Female hypogonadism ( )
Obsolete ovarioleukodystrophy ( )
Advanced cancer ( )
Melanoma ( )
Neoplasm ( )
Nervous system disease ( )
Parkinson disease ( )
UniProt ID
EI2BB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6CAJ; 6EZO; 6K71; 6K72; 6O81; 6O85; 6O9Z; 7D43; 7D44; 7D45; 7D46; 7F64; 7F66; 7F67; 7KMF; 7L70; 7L7G; 7RLO; 7TRJ; 7VLK; 8TQO; 8TQZ
Pfam ID
PF01008
Sequence
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Function
Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit. Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed.
KEGG Pathway
Herpes simplex virus 1 infection (hsa05168 )
Reactome Pathway
Recycling of eIF2 (R-HSA-72731 )

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Leishmaniasis DISABTW7 Definitive Biomarker [1]
Obsolete leukoencephalopathy with vanishing white matter DISBOYFO Definitive Autosomal recessive [2]
Brain disease DIS6ZC3X Strong Genetic Variation [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Cerebellar ataxia DIS9IRAV Strong Genetic Variation [5]
Diffuse systemic sclerosis DISYF5LP Strong Biomarker [6]
Leukoencephalopathy with vanishing white matter 1 DIS72ZXN Strong Autosomal recessive [2]
Neurodevelopmental disorder DIS372XH Strong Genetic Variation [7]
Scleroderma DISVQ342 Strong Biomarker [6]
Systemic sclerosis DISF44L6 Strong Biomarker [6]
Adrenocortical insufficiency DISZ0CPT moderate Genetic Variation [8]
Adrenoleukodystrophy DISTUD1F moderate Genetic Variation [8]
Female hypogonadism DISWASB4 moderate Biomarker [9]
Obsolete ovarioleukodystrophy DIS0K85C Supportive Autosomal recessive [10]
Advanced cancer DISAT1Z9 Disputed Altered Expression [11]
Melanoma DIS1RRCY Limited Biomarker [12]
Neoplasm DISZKGEW Limited Biomarker [13]
Nervous system disease DISJ7GGT Limited Genetic Variation [14]
Parkinson disease DISQVHKL Limited Biomarker [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [16]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [17]
Quercetin DM3NC4M Approved Quercetin increases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [18]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [19]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Translation initiation factor eIF2B subunit beta (EIF2B2). [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Analysis of the Antigenic and Prophylactic Properties of the Leishmania Translation Initiation Factors eIF2 and eIF2B in Natural and Experimental Leishmaniasis.Front Cell Infect Microbiol. 2018 Apr 5;8:112. doi: 10.3389/fcimb.2018.00112. eCollection 2018.
2 Subunits of the translation initiation factor eIF2B are mutant in leukoencephalopathy with vanishing white matter. Nat Genet. 2001 Dec;29(4):383-8. doi: 10.1038/ng764.
3 Mutations causing childhood ataxia with central nervous system hypomyelination reduce eukaryotic initiation factor 2B complex formation and activity.Mol Cell Biol. 2004 Mar;24(6):2352-63. doi: 10.1128/MCB.24.6.2352-2363.2004.
4 The PI3K/Akt/GSK-3/ROS/eIF2B pathway promotes breast cancer growth and metastasis via suppression of NK cell cytotoxicity and tumor cell susceptibility.Cancer Biol Med. 2019 Feb;16(1):38-54. doi: 10.20892/j.issn.2095-3941.2018.0253.
5 Childhood ataxia with CNS hypomyelination/vanishing white matter disease--a common leukodystrophy caused by abnormal control of protein synthesis.Mol Genet Metab. 2006 May;88(1):7-15. doi: 10.1016/j.ymgme.2005.10.019. Epub 2006 Jan 18.
6 Presence of anti-eukaryotic initiation factor-2B, anti-RuvBL1/2 and anti-synthetase antibodies in patients with anti-nuclear antibody negative systemic sclerosis.Rheumatology (Oxford). 2018 Apr 1;57(4):712-717. doi: 10.1093/rheumatology/kex458.
7 Identification of novel genetic causes of Rett syndrome-like phenotypes. J Med Genet. 2016 Mar;53(3):190-9. doi: 10.1136/jmedgenet-2015-103568. Epub 2016 Jan 6.
8 Vanishing white matter disease caused by EIF2B2 mutation with the presentation of an adrenoleukodystrophy phenotype.Gene. 2012 Apr 1;496(2):141-3. doi: 10.1016/j.gene.2011.12.047. Epub 2012 Jan 17.
9 The latest on leukodystrophies.Curr Opin Neurol. 2004 Apr;17(2):187-92. doi: 10.1097/00019052-200404000-00017.
10 Childhood Ataxia with Central Nervous System Hypomyelination / Vanishing White Matter. 2003 Feb 20 [updated 2019 Apr 4]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
11 Novel mechanisms of eIF2B action and regulation by eIF2 phosphorylation.Nucleic Acids Res. 2017 Nov 16;45(20):11962-11979. doi: 10.1093/nar/gkx845.
12 Translation reprogramming is an evolutionarily conserved driver of phenotypic plasticity and therapeutic resistance in melanoma.Genes Dev. 2017 Jan 1;31(1):18-33. doi: 10.1101/gad.290940.116. Epub 2017 Jan 17.
13 High EIF2B5 mRNA expression and its prognostic significance in liver cancer: a study based on the TCGA and GEO database.Cancer Manag Res. 2018 Nov 20;10:6003-6014. doi: 10.2147/CMAR.S185459. eCollection 2018.
14 eIF2B: recent structural and functional insights into a key regulator of translation.Biochem Soc Trans. 2015 Dec;43(6):1234-40. doi: 10.1042/BST20150164.
15 Identification of risk and age-at-onset genes on chromosome 1p in Parkinson disease.Am J Hum Genet. 2005 Aug;77(2):252-64. doi: 10.1086/432588. Epub 2005 Jun 28.
16 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
17 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
18 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
19 Proteomic analysis of antiproliferative effects by treatment of 5-fluorouracil in cervical cancer cells. DNA Cell Biol. 2004 Nov;23(11):769-76.
20 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
21 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.