Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQZ36F3)

DOT Name Cathepsin D (CTSD)
Synonyms EC 3.4.23.5
Gene Name CTSD
Related Disease
Neuronal ceroid lipofuscinosis ( )
Neuronal ceroid lipofuscinosis 10 ( )
UniProt ID
CATD_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1LYA; 1LYB; 1LYW; 4OBZ; 4OC6; 4OD9
EC Number
3.4.23.5
Pfam ID
PF07966 ; PF00026
Sequence
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Function
Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Tissue Specificity Expressed in the aorta extracellular space (at protein level) . Expressed in liver (at protein level) .
KEGG Pathway
Sphingolipid sig.ling pathway (hsa04071 )
Autophagy - animal (hsa04140 )
Lysosome (hsa04142 )
Apoptosis (hsa04210 )
Estrogen sig.ling pathway (hsa04915 )
Tuberculosis (hsa05152 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )
MHC class II antigen presentation (R-HSA-2132295 )
Neutrophil degranulation (R-HSA-6798695 )
Insulin receptor recycling (R-HSA-77387 )
Estrogen-dependent gene expression (R-HSA-9018519 )
Collagen degradation (R-HSA-1442490 )
BioCyc Pathway
MetaCyc:HS04183-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neuronal ceroid lipofuscinosis DIS9A4K4 Definitive Autosomal recessive [1]
Neuronal ceroid lipofuscinosis 10 DISK49S1 Definitive Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Cathepsin D (CTSD). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Cathepsin D (CTSD). [42]
------------------------------------------------------------------------------------
51 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Cathepsin D (CTSD). [4]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Cathepsin D (CTSD). [5]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Cathepsin D (CTSD). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Cathepsin D (CTSD). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cathepsin D (CTSD). [8]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Cathepsin D (CTSD). [9]
Quercetin DM3NC4M Approved Quercetin increases the expression of Cathepsin D (CTSD). [10]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Cathepsin D (CTSD). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Cathepsin D (CTSD). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Cathepsin D (CTSD). [13]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cathepsin D (CTSD). [14]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Cathepsin D (CTSD). [15]
Triclosan DMZUR4N Approved Triclosan increases the expression of Cathepsin D (CTSD). [16]
Marinol DM70IK5 Approved Marinol increases the expression of Cathepsin D (CTSD). [17]
Progesterone DMUY35B Approved Progesterone increases the expression of Cathepsin D (CTSD). [18]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Cathepsin D (CTSD). [19]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Cathepsin D (CTSD). [20]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Cathepsin D (CTSD). [21]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Cathepsin D (CTSD). [22]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Cathepsin D (CTSD). [23]
Dopamine DMPGUCF Approved Dopamine increases the expression of Cathepsin D (CTSD). [24]
Glucosamine DM4ZLFD Approved Glucosamine decreases the expression of Cathepsin D (CTSD). [25]
Amodiaquine DME4RA8 Approved Amodiaquine decreases the activity of Cathepsin D (CTSD). [26]
Miconazole DMPMYE8 Approved Miconazole increases the expression of Cathepsin D (CTSD). [27]
ARZOXIFENE DMOKCVI Approved ARZOXIFENE decreases the expression of Cathepsin D (CTSD). [28]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Cathepsin D (CTSD). [30]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Cathepsin D (CTSD). [5]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Cathepsin D (CTSD). [31]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Cathepsin D (CTSD). [32]
I3C DMIGFOR Phase 3 I3C decreases the expression of Cathepsin D (CTSD). [33]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Cathepsin D (CTSD). [7]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of Cathepsin D (CTSD). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Cathepsin D (CTSD). [36]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the expression of Cathepsin D (CTSD). [31]
Scriptaid DM9JZ21 Preclinical Scriptaid affects the expression of Cathepsin D (CTSD). [38]
EMODIN DMAEDQG Terminated EMODIN decreases the expression of Cathepsin D (CTSD). [39]
WIN-55212-2 DMACBIW Terminated WIN-55212-2 increases the expression of Cathepsin D (CTSD). [40]
Pepstatin DM9S1EA Terminated Pepstatin decreases the activity of Cathepsin D (CTSD). [41]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Cathepsin D (CTSD). [43]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Cathepsin D (CTSD). [44]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Cathepsin D (CTSD). [45]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Cathepsin D (CTSD). [46]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone decreases the expression of Cathepsin D (CTSD). [47]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal increases the expression of Cathepsin D (CTSD). [48]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Cathepsin D (CTSD). [49]
PP-242 DM2348V Investigative PP-242 increases the expression of Cathepsin D (CTSD). [50]
Linalool DMGZQ5P Investigative Linalool increases the expression of Cathepsin D (CTSD). [51]
N-nonylphenol DMH3OUX Investigative N-nonylphenol increases the expression of Cathepsin D (CTSD). [52]
Tetramethylbutylphenol DMW9CH2 Investigative Tetramethylbutylphenol increases the expression of Cathepsin D (CTSD). [53]
eucalyptol DME5CK3 Investigative eucalyptol increases the expression of Cathepsin D (CTSD). [54]
brucine DM50RUD Investigative brucine decreases the expression of Cathepsin D (CTSD). [55]
------------------------------------------------------------------------------------
⏷ Show the Full List of 51 Drug(s)
6 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Berberine DMC5Q8X Phase 4 Berberine decreases the cleavage of Cathepsin D (CTSD). [29]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone affects the cleavage of Cathepsin D (CTSD). [34]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the cleavage of Cathepsin D (CTSD). [29]
MG-132 DMKA2YS Preclinical MG-132 increases the cleavage of Cathepsin D (CTSD). [37]
AHPN DM8G6O4 Investigative AHPN increases the localization of Cathepsin D (CTSD). [41]
Bafilomycin A1 DMUNK59 Investigative Bafilomycin A1 decreases the cleavage of Cathepsin D (CTSD). [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Cathepsin D deficiency is associated with a human neurodegenerative disorder. Am J Hum Genet. 2006 Jun;78(6):988-98. doi: 10.1086/504159. Epub 2006 Mar 29.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 The two phyto-oestrogens genistein and quercetin exert different effects on oestrogen receptor function. Br J Cancer. 1999 Jun;80(8):1150-5. doi: 10.1038/sj.bjc.6690479.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Arsenic modulates posttranslational S-nitrosylation and translational proteome in keratinocytes. ScientificWorldJournal. 2014;2014:360153.
10 The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells. J Biol Chem. 2004 Jun 25;279(26):27008-16. doi: 10.1074/jbc.M403588200. Epub 2004 Apr 16.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Src Family Kinase Inhibitor PP2 Has Different Effects on All-Trans-Retinoic Acid or Arsenic Trioxide-Induced Differentiation of an Acute Promyelocytic Leukemia Cell Line. Cancer Res Treat. 2013 Jun;45(2):126-33. doi: 10.4143/crt.2013.45.2.126. Epub 2013 Jun 30.
13 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
14 Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
15 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
16 Inhibitory effects of 3,3'-diindolylmethane on epithelial-mesenchymal transition induced by endocrine disrupting chemicals in cellular and xenograft mouse models of breast cancer. Food Chem Toxicol. 2017 Nov;109(Pt 1):284-295. doi: 10.1016/j.fct.2017.08.037. Epub 2017 Aug 24.
17 Genomic and proteomic analysis of the effects of cannabinoids on normal human astrocytes. Brain Res. 2008 Jan 29;1191:1-11.
18 Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
19 Resveratrol modulates the phosphoinositide 3-kinase pathway through an estrogen receptor alpha-dependent mechanism: relevance in cell proliferation. Int J Cancer. 2004 Mar 20;109(2):167-73. doi: 10.1002/ijc.11720.
20 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
21 Niclosamide, an oral antihelmintic drug, exhibits antimetastatic activity in hepatocellular carcinoma cells through downregulating twist-mediated CD10 expression. Environ Toxicol. 2018 Jun;33(6):659-669.
22 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
23 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
24 Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
25 Glucosamine sulfate-induced apoptosis in chronic myelogenous leukemia K562 cells is associated with translocation of cathepsin D and downregulation of Bcl-xL. Apoptosis. 2006 Oct;11(10):1851-60. doi: 10.1007/s10495-006-9529-6.
26 The antimalarial amodiaquine causes autophagic-lysosomal and proliferative blockade sensitizing human melanoma cells to starvation- and chemotherapy-induced cell death. Autophagy. 2013 Dec;9(12):2087-102. doi: 10.4161/auto.26506. Epub 2013 Oct 8.
27 Miconazole induces protective autophagy in bladder cancer cells. Environ Toxicol. 2021 Feb;36(2):185-193. doi: 10.1002/tox.23024. Epub 2020 Sep 27.
28 The effect of the new SERM arzoxifene on growth and gene expression in MCF-7 breast cancer cells. Mol Cell Endocrinol. 2004 Apr 30;219(1-2):27-36. doi: 10.1016/j.mce.2004.02.003.
29 Berbamine Hydrochloride inhibits lysosomal acidification by activating Nox2 to potentiate chemotherapy-induced apoptosis via the ROS-MAPK pathway in human lung carcinoma cells. Cell Biol Toxicol. 2023 Aug;39(4):1297-1317. doi: 10.1007/s10565-022-09756-8. Epub 2022 Sep 7.
30 Structure-activity relationships of resveratrol and derivatives in breast cancer cells. Mol Nutr Food Res. 2009 Jul;53(7):845-58. doi: 10.1002/mnfr.200800331.
31 Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
32 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
33 Indole-3-carbinol is a negative regulator of estrogen receptor-alpha signaling in human tumor cells. J Nutr. 2000 Dec;130(12):2927-31. doi: 10.1093/jn/130.12.2927.
34 A role for the autophagy regulator Transcription Factor EB in amiodarone-induced phospholipidosis. Biochem Pharmacol. 2015 Jun 1;95(3):201-9. doi: 10.1016/j.bcp.2015.03.017. Epub 2015 Apr 13.
35 Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
36 Differential action of chlorinated polycyclic aromatic hydrocarbons on aryl hydrocarbon receptor-mediated signaling in breast cancer cells. Environ Toxicol. 2010 Apr;25(2):180-7.
37 The unfolded protein response controls ER stress-induced apoptosis of lung epithelial cells through angiotensin generation. Am J Physiol Lung Cell Mol Physiol. 2016 Nov 1;311(5):L846-L854. doi: 10.1152/ajplung.00449.2015. Epub 2016 Sep 16.
38 Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
39 Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
40 WIN55,212-2 induces caspase-independent apoptosis on human glioblastoma cells by regulating HSP70, p53 and Cathepsin D. Toxicol In Vitro. 2019 Jun;57:233-243. doi: 10.1016/j.tiv.2019.02.009. Epub 2019 Feb 15.
41 Evidence of a lysosomal pathway for apoptosis induced by the synthetic retinoid CD437 in human leukemia HL-60 cells. Cell Death Differ. 2001 May;8(5):477-85. doi: 10.1038/sj.cdd.4400843.
42 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
43 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
44 Celecoxib promotes survival and upregulates the expression of neuroprotective marker genes in two different in vitro models of Parkinson's disease. Neuropharmacology. 2021 Aug 15;194:108378. doi: 10.1016/j.neuropharm.2020.108378. Epub 2020 Nov 6.
45 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
46 Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
47 Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
48 Upregulation of the TFEB-mediated lysosome function relieves 4-Hydroxynonenal-Induced apoptosis. Chem Biol Interact. 2022 Aug 1;362:109963. doi: 10.1016/j.cbi.2022.109963. Epub 2022 May 9.
49 The cooked meat-derived mammary carcinogen 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine promotes invasive behaviour of breast cancer cells. Toxicology. 2011 Jan 11;279(1-3):139-45.
50 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
51 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
52 Influence of hexabromocyclododecane and 4-nonylphenol on the regulation of cell growth, apoptosis and migration in prostatic cancer cells. Toxicol In Vitro. 2016 Apr;32:240-7. doi: 10.1016/j.tiv.2016.01.008. Epub 2016 Jan 19.
53 4-tert-Octylphenol stimulates the expression of cathepsins in human breast cancer cells and xenografted breast tumors of a mouse model via an estrogen receptor-mediated signaling pathway. Toxicology. 2013 Feb 8;304:13-20. doi: 10.1016/j.tox.2012.10.012. Epub 2012 Dec 3.
54 Lavender Products Associated With Premature Thelarche and Prepubertal Gynecomastia: Case Reports and Endocrine-Disrupting Chemical Activities. J Clin Endocrinol Metab. 2019 Nov 1;104(11):5393-5405. doi: 10.1210/jc.2018-01880.
55 Brucine, an alkaloid from seeds of Strychnos nux-vomica Linn., represses hepatocellular carcinoma cell migration and metastasis: the role of hypoxia inducible factor 1 pathway. Toxicol Lett. 2013 Oct 24;222(2):91-101. doi: 10.1016/j.toxlet.2013.07.024. Epub 2013 Aug 7.