Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS03CZC)

DOT Name Endomucin (EMCN)
Synonyms Endomucin-2; Gastric cancer antigen Ga34; Mucin-14; MUC-14
Gene Name EMCN
Related Disease
Neoplasm ( )
Acute lymphocytic leukaemia ( )
Angiosarcoma ( )
Atopic dermatitis ( )
Childhood acute lymphoblastic leukemia ( )
Diabetic retinopathy ( )
Hemangioma ( )
Hyperglycemia ( )
Major depressive disorder ( )
Mood disorder ( )
Skin disease ( )
T-cell lymphoma ( )
Type-1/2 diabetes ( )
Rheumatoid arthritis ( )
UniProt ID
MUCEN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07010
Sequence
MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTT
PKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQ
SSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNAS
TSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKL
LTVKTISHESGEHSAQGKTKN
Function
Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix.
Tissue Specificity Expressed in heart, kidney and lung.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [2]
Angiosarcoma DISIYS9W Strong Altered Expression [3]
Atopic dermatitis DISTCP41 Strong Altered Expression [3]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [2]
Diabetic retinopathy DISHGUJM Strong Biomarker [4]
Hemangioma DISDCGAG Strong Altered Expression [3]
Hyperglycemia DIS0BZB5 Strong Altered Expression [4]
Major depressive disorder DIS4CL3X Strong Genetic Variation [5]
Mood disorder DISLVMWO Strong Genetic Variation [5]
Skin disease DISDW8R6 Strong Altered Expression [3]
T-cell lymphoma DISSXRTQ Strong Altered Expression [3]
Type-1/2 diabetes DISIUHAP Strong Biomarker [4]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Endomucin (EMCN). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Endomucin (EMCN). [8]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Endomucin (EMCN). [9]
Warfarin DMJYCVW Approved Warfarin decreases the expression of Endomucin (EMCN). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Endomucin (EMCN). [8]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Endomucin (EMCN). [11]
------------------------------------------------------------------------------------

References

1 High-Dose Radiation Increases Notch1 in Tumor Vasculature.Int J Radiat Oncol Biol Phys. 2020 Mar 15;106(4):857-866. doi: 10.1016/j.ijrobp.2019.11.010. Epub 2019 Nov 20.
2 A leukemia-enriched cDNA microarray platform identifies new transcripts with relevance to the biology of pediatric acute lymphoblastic leukemia.Haematologica. 2005 Jul;90(7):890-8.
3 Expression of endomucin, a novel endothelial sialomucin, in normal and diseased human skin.J Invest Dermatol. 2002 Dec;119(6):1388-93. doi: 10.1046/j.1523-1747.2002.19647.x.
4 Endomucin restores depleted endothelial glycocalyx in the retinas of streptozotocin-induced diabetic rats.FASEB J. 2019 Dec;33(12):13346-13357. doi: 10.1096/fj.201901161R. Epub 2019 Sep 21.
5 Meta-analysis of genome-wide association studies for neuroticism in 449,484 individuals identifies novel genetic loci and pathways.Nat Genet. 2018 Jul;50(7):920-927. doi: 10.1038/s41588-018-0151-7. Epub 2018 Jun 25.
6 Genome-wide association study of response to tumour necrosis factor inhibitor therapy in rheumatoid arthritis.Pharmacogenomics J. 2018 Sep;18(5):657-664. doi: 10.1038/s41397-018-0040-6. Epub 2018 Aug 31.
7 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
8 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
9 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
10 Warfarin Blocks Gas6-Mediated Axl Activation Required for Pancreatic Cancer Epithelial Plasticity and Metastasis. Cancer Res. 2015 Sep 15;75(18):3699-705. doi: 10.1158/0008-5472.CAN-14-2887-T. Epub 2015 Jul 23.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.