Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSLKKCO)

DOT Name M-phase inducer phosphatase 1 (CDC25A)
Synonyms EC 3.1.3.48; Dual specificity phosphatase Cdc25A
Gene Name CDC25A
UniProt ID
MPIP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1C25
EC Number
3.1.3.48
Pfam ID
PF06617 ; PF00581
Sequence
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
Function
Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 in complex with cyclin-E, in vitro.
KEGG Pathway
Cell cycle (hsa04110 )
Cellular senescence (hsa04218 )
Progesterone-mediated oocyte maturation (hsa04914 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Reactome Pathway
Polo-like kinase mediated events (R-HSA-156711 )
Activation of ATR in response to replication stress (R-HSA-176187 )
Ub-specific processing proteases (R-HSA-5689880 )
Cyclin E associated events during G1/S transition (R-HSA-69202 )
Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273 )
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 )
Cyclin A (R-HSA-69656 )
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803 )
Transcription of E2F targets under negative control by DREAM complex (R-HSA-1362277 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
44 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of M-phase inducer phosphatase 1 (CDC25A). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of M-phase inducer phosphatase 1 (CDC25A). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of M-phase inducer phosphatase 1 (CDC25A). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [10]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [11]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [13]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [14]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [15]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [16]
Ethanol DMDRQZU Approved Ethanol decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [17]
Aspirin DM672AH Approved Aspirin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [18]
Etoposide DMNH3PG Approved Etoposide decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [7]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [19]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of M-phase inducer phosphatase 1 (CDC25A). [20]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [21]
Daunorubicin DMQUSBT Approved Daunorubicin increases the expression of M-phase inducer phosphatase 1 (CDC25A). [22]
Palbociclib DMD7L94 Approved Palbociclib decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [23]
Colchicine DM2POTE Approved Colchicine decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [7]
Adenine DMZLHKJ Approved Adenine decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [7]
Teriflunomide DMQ2FKJ Approved Teriflunomide decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [26]
Silymarin DMXBYQR Phase 4 Silymarin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [27]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [28]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [29]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of M-phase inducer phosphatase 1 (CDC25A). [30]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [31]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [33]
AT7519 DMCE08M Phase 1 AT7519 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [35]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [36]
Harmine DMPA5WD Patented Harmine increases the expression of M-phase inducer phosphatase 1 (CDC25A). [37]
Taxifolin DMQJSF9 Preclinical Taxifolin decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [39]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of M-phase inducer phosphatase 1 (CDC25A). [40]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [41]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of M-phase inducer phosphatase 1 (CDC25A). [8]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [42]
geraniol DMS3CBD Investigative geraniol decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [43]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [10]
GW-3965 DMG60ET Investigative GW-3965 decreases the expression of M-phase inducer phosphatase 1 (CDC25A). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved Methotrexate increases the degradation of M-phase inducer phosphatase 1 (CDC25A). [12]
Nelfinavir mesylate DMFX6G8 Approved Nelfinavir mesylate increases the degradation of M-phase inducer phosphatase 1 (CDC25A). [25]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Thioridazine DM35M8J Approved Thioridazine increases the phosphorylation of M-phase inducer phosphatase 1 (CDC25A). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of M-phase inducer phosphatase 1 (CDC25A). [32]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of M-phase inducer phosphatase 1 (CDC25A). [34]
------------------------------------------------------------------------------------

References

1 Effects of valproic acid and levetiracetam on viability and cell cycle regulatory genes expression in the OVCAR-3 cell line. Pharmacol Rep. 2012;64(1):157-65. doi: 10.1016/s1734-1140(12)70742-9.
2 Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Exploring pradimicin-IRD antineoplastic mechanisms and related DNA repair pathways. Chem Biol Interact. 2023 Feb 1;371:110342. doi: 10.1016/j.cbi.2023.110342. Epub 2023 Jan 10.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
8 Differential effect of methyl-, butyl- and propylparaben and 17-estradiol on selected cell cycle and apoptosis gene and protein expression in MCF-7 breast cancer cells and MCF-10A non-malignant cells. J Appl Toxicol. 2014 Sep;34(9):1041-50. doi: 10.1002/jat.2978. Epub 2014 Jan 30.
9 Activation of the p38 MAPK/Akt/ERK1/2 signal pathways is required for the protein stabilization of CDC6 and cyclin D1 in low-dose arsenite-induced cell proliferation. J Cell Biochem. 2010 Dec 15;111(6):1546-55. doi: 10.1002/jcb.22886.
10 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
11 Vitamin D receptor as a master regulator of the c-MYC/MXD1 network. Proc Natl Acad Sci U S A. 2012 Nov 13;109(46):18827-32. doi: 10.1073/pnas.1210037109. Epub 2012 Oct 29.
12 Melanoma coordinates general and cell-specific mechanisms to promote methotrexate resistance. Exp Cell Res. 2012 Jun 10;318(10):1146-59.
13 Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
14 Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
15 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
16 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
17 Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
18 Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
19 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
20 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
21 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
22 Daunorubicin-induced variations in gene transcription: commitment to proliferation arrest, senescence and apoptosis. Biochem J. 2003 Jun 15;372(Pt 3):703-11. doi: 10.1042/BJ20021950.
23 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
24 A gene signature-based approach identifies thioridazine as an inhibitor of phosphatidylinositol-3'-kinase (PI3K)/AKT pathway in ovarian cancer cells. Gynecol Oncol. 2011 Jan;120(1):121-7. doi: 10.1016/j.ygyno.2010.10.003. Epub 2010 Oct 29.
25 HIV protease inhibitor nelfinavir inhibits growth of human melanoma cells by induction of cell cycle arrest. Cancer Res. 2007 Feb 1;67(3):1221-7. doi: 10.1158/0008-5472.CAN-06-3377.
26 Dihydroorotate dehydrogenase inhibitor A771726 (leflunomide) induces apoptosis and diminishes proliferation of multiple myeloma cells. Mol Cancer Ther. 2009 Feb;8(2):366-75. doi: 10.1158/1535-7163.MCT-08-0664. Epub 2009 Jan 27.
27 Identifying the differential effects of silymarin constituents on cell growth and cell cycle regulatory molecules in human prostate cancer cells. Int J Cancer. 2008 Jul 1;123(1):41-50. doi: 10.1002/ijc.23485.
28 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
29 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
30 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
31 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
32 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
33 BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
34 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
35 CDK Blockade Using AT7519 Suppresses Acute Myeloid Leukemia Cell Survival through the Inhibition of Autophagy and Intensifies the Anti-leukemic Effect of Arsenic Trioxide. Iran J Pharm Res. 2019 Fall;18(Suppl1):119-131. doi: 10.22037/ijpr.2019.112560.13827.
36 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
37 A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication. Nat Med. 2015 Apr;21(4):383-8. doi: 10.1038/nm.3820. Epub 2015 Mar 9.
38 The chemopreventive effect of taxifolin is exerted through ARE-dependent gene regulation. Biol Pharm Bull. 2007 Jun;30(6):1074-9.
39 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
40 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
41 Molecular signatures of cytotoxic effects in human embryonic kidney 293?cells treated with single and mixture of ochratoxin A and citrinin. Food Chem Toxicol. 2019 Jan;123:374-384. doi: 10.1016/j.fct.2018.11.015. Epub 2018 Nov 11.
42 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
43 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
44 System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.