Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSWB4SZ)

• DOT Name: OCIA domain-containing protein 2 (OCIAD2)
• Synonyms: Ovarian carcinoma immunoreactive antigen-like protein
• Gene Name: OCIAD2
• Related Disease:
  Adenocarcinoma
  Adenocarcinoma in situ
  Alzheimer disease
  Androgen insensitivity syndrome
  Lung adenocarcinoma
  Neoplasm
  Advanced cancer
  Hepatocellular carcinoma
  Minimally invasive lung adenocarcinoma
  Metastatic malignant neoplasm
• UniProt ID: OCAD2_HUMAN
• Pfam ID: PF07051
• Sequence:
  MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSL
  VSMLVTQGLVYQGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGA
  GFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Adenocarcinoma in situ	DISSTE29	Strong	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[2]
Androgen insensitivity syndrome	DISUZBBO	Strong	Altered Expression	[1]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[3]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[4]
Minimally invasive lung adenocarcinoma	DIS4W83X	moderate	Altered Expression	[5]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of OCIA domain-containing protein 2 (OCIAD2).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of OCIA domain-containing protein 2 (OCIAD2).	[17]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[9]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of OCIA domain-containing protein 2 (OCIAD2).	[10]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[11]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of OCIA domain-containing protein 2 (OCIAD2).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of OCIA domain-containing protein 2 (OCIAD2).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of OCIA domain-containing protein 2 (OCIAD2).	[10]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[15]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[16]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[18]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[19]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of OCIA domain-containing protein 2 (OCIAD2).	[20]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of OCIA domain-containing protein 2 (OCIAD2).	[21]

References

• [1] High expression of ovarian cancer immunoreactive antigen domain containing 2 (OCIAD2) is associated with poor prognosis in lung adenocarcinoma.Pathol Int. 2018 Nov;68(11):596-604. doi: 10.1111/pin.12724. Epub 2018 Oct 15.
• [2] OCIAD2 activates -secretase to enhance amyloid production by interacting with nicastrin.Cell Mol Life Sci. 2014 Jul;71(13):2561-76. doi: 10.1007/s00018-013-1515-x. Epub 2013 Nov 24.
• [3] Pathway bridge based multiobjective optimization approach for lurking pathway prediction.Biomed Res Int. 2014;2014:351095. doi: 10.1155/2014/351095. Epub 2014 Apr 16.
• [4] OCIAD2 suppressed tumor growth and invasion via AKT pathway in Hepatocelluar carcinoma.Carcinogenesis. 2017 Sep 1;38(9):910-919. doi: 10.1093/carcin/bgx073.
• [5] OCIA domain containing 2 is highly expressed in adenocarcinoma mixed subtype with bronchioloalveolar carcinoma component and is associated with better prognosis.Cancer Sci. 2007 Jan;98(1):50-7. doi: 10.1111/j.1349-7006.2006.00346.x.
• [6] A double helical motif in OCIAD2 is essential for its localization, interactions and STAT3 activation.Sci Rep. 2018 May 9;8(1):7362. doi: 10.1038/s41598-018-25667-3.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [10] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [11] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [12] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [13] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [14] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [15] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [16] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [17] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [18] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [19] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [20] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [21] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.