Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU8XLAF)

• DOT Name: Oligodendrocyte transcription factor 3 (OLIG3)
• Synonyms: Oligo3; Class B basic helix-loop-helix protein 7; bHLHb7; Class E basic helix-loop-helix protein 20; bHLHe20
• Gene Name: OLIG3
• Related Disease:
  Coeliac disease
  Psoriasis
  Rheumatoid arthritis
• UniProt ID: OLIG3_HUMAN
• Pfam ID: PF00010
• Sequence:
  MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
  AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
  LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP
  VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
  CTICQMPPPPHLSALSTANMARLSAESKDLLK
• Function: May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coeliac disease	DISIY60C	Strong	Genetic Variation	[1]
Psoriasis	DIS59VMN	Strong	Biomarker	[2]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[3]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Oligodendrocyte transcription factor 3 (OLIG3) increases the Metabolic disorder ADR of Chlorothiazide.	[11]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[6]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Nilotinib	DM7HXWT	Approved	Nilotinib increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Abacavir	DMMN36E	Approved	Abacavir increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Polyethylene glycol	DM4I1JP	Approved	Polyethylene glycol increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Dabigatran	DMDI6R4	Approved	Dabigatran increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
Ramelteon	DM7IW9J	Approved	Ramelteon decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[5]
SB-431542	DM0YOXQ	Preclinical	SB-431542 decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Oligodendrocyte transcription factor 3 (OLIG3).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Oligodendrocyte transcription factor 3 (OLIG3).	[7]

References

• [1] Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.Gut. 2009 Aug;58(8):1078-83. doi: 10.1136/gut.2008.169052. Epub 2009 Feb 24.
• [2] Unraveling the genetics of complex diseases: susceptibility genes for rheumatoid arthritis and psoriasis.Semin Immunol. 2009 Dec;21(6):318-27. doi: 10.1016/j.smim.2009.04.002. Epub 2009 May 14.
• [3] Whole exome sequencing in Finnish families identifies new candidate genes for osteoarthritis.PLoS One. 2018 Aug 29;13(8):e0203313. doi: 10.1371/journal.pone.0203313. eCollection 2018.
• [4] Neuronal and cardiac toxicity of pharmacological compounds identified through transcriptomic analysis of human pluripotent stem cell-derived embryoid bodies. Toxicol Appl Pharmacol. 2021 Dec 15;433:115792. doi: 10.1016/j.taap.2021.115792. Epub 2021 Nov 3.
• [5] Exposure-based assessment of chemical teratogenicity using morphogenetic aggregates of human embryonic stem cells. Reprod Toxicol. 2020 Jan;91:74-91. doi: 10.1016/j.reprotox.2019.10.004. Epub 2019 Nov 8.
• [6] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [9] Transcriptomic?pathway?and?benchmark dose analysis of Bisphenol A, Bisphenol S, Bisphenol F, and 3,3',5,5'-Tetrabromobisphenol A in H9 human embryonic stem cells. Toxicol In Vitro. 2021 Apr;72:105097. doi: 10.1016/j.tiv.2021.105097. Epub 2021 Jan 18.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [11] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.