Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUMCWRN)

• DOT Name: DBH-like monooxygenase protein 1 (MOXD1)
• Synonyms: EC 1.14.17.-; Monooxygenase X
• Gene Name: MOXD1
• Related Disease:
  Asthma
  Schizophrenia
  Tuberculosis
  Osteomyelitis
  Pneumonia
• UniProt ID: MOXD1_HUMAN
• EC Number: 1.14.17.-
• Pfam ID: PF03712 ; PF01082 ; PF03351
• Sequence:
  MCCWPLLLLWGLLPGTAAGGSGRTYPHRTLLDSEGKYWLGWSQRGSQIAFRLQVRTAGYV
  GFGFSPTGAMASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTII
  EFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVL
  STALPYFDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPVIQRGHESLVHHILLY
  QCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPH
  YVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQS
  EGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFN
  FQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRC
  ASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKL
  VLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVC
  LLLLSCTLSTKSL
• Tissue Specificity: Highly expressed in lung, kidney, brain and spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Asthma	DISW9QNS	Definitive	Altered Expression	[1]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[2]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[3]
Osteomyelitis	DIS0VUZL	Limited	Biomarker	[4]
Pneumonia	DIS8EF3M	Limited	Biomarker	[5]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[7]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[8]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[11]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DBH-like monooxygenase protein 1 (MOXD1).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[14]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[16]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[17]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of DBH-like monooxygenase protein 1 (MOXD1).	[18]

References

• [1] Implications of prostaglandin D2 and leukotrienes in exhaled breath condensates of asthma.Ann Allergy Asthma Immunol. 2019 Jul;123(1):81-88.e1. doi: 10.1016/j.anai.2019.04.008. Epub 2019 Apr 12.
• [2] Polymorphisms in the trace amine receptor 4 (TRAR4) gene on chromosome 6q23.2 are associated with susceptibility to schizophrenia.Am J Hum Genet. 2004 Oct;75(4):624-38. doi: 10.1086/424887. Epub 2004 Aug 24.
• [3] Second-line anti-tuberculosis drug resistance testing in Ghana identifies the first extensively drug-resistant tuberculosis case.Infect Drug Resist. 2018 Feb 22;11:239-246. doi: 10.2147/IDR.S152720. eCollection 2018.
• [4] Preparation, in vitro release and antibacterial activity evaluation of rifampicin and moxifloxacin-loaded poly(D,L-lactide-co-glycolide) microspheres.Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):790-798. doi: 10.1080/21691401.2019.1581792.
• [5] Emergence of CTX-M-3, TEM-1 and a new plasmid-mediated MOX-4 AmpC in a multiresistant Aeromonas caviae isolate from a patient with pneumonia.J Med Microbiol. 2010 Jul;59(Pt 7):843-847. doi: 10.1099/jmm.0.016337-0. Epub 2010 Mar 25.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [8] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [9] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [13] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [14] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [15] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [16] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [17] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [18] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.