Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUX3S2I)

• DOT Name: Fibronectin type-III domain-containing protein 3A (FNDC3A)
• Synonyms: Human gene expressed in odontoblasts
• Gene Name: FNDC3A
• Related Disease:
  Advanced cancer
  Amyotrophic lateral sclerosis
  Autism spectrum disorder
  Bipolar disorder
  Classic Hodgkin lymphoma
  Epithelial ovarian cancer
  Glioma
  Lung cancer
  Lung carcinoma
  Ocular albinism
  Ovarian cancer
  Ovarian neoplasm
  Pervasive developmental disorder
  Peutz-Jeghers syndrome
  Pheochromocytoma
  Prostate carcinoma
  Psoriasis
  Wilson disease
  Retinoschisis
  Ectodermal dysplasia
  Ankylosing spondylitis
  Crohn disease
  Neoplasm
  Sclerosing cholangitis
  Ulcerative colitis
• UniProt ID: FND3A_HUMAN
• PDB ID: 1WK0; 1X3D; 1X4X; 1X5X; 2CRM; 2CRZ
• Pfam ID: PF00041
• Sequence:
  MAEHPPLLDTTQILSSDISLLSAPIVSADGTQQVILVQVNPGEAFTIRREDGQFQCITGP
  AQVPMMSPNGSVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPHPPLP
  GFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSS
  KTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSG
  KGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGETDES
  SVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSE
  AEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQC
  YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLTKAGI
  TWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKV
  IAYNSEGKSNPSEVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYV
  VEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAV
  PPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVEC
  TVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAPGPPDQCKPPQVTCRSATCAQVNWE
  VPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPF
  SEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFG
  DKQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECV
  AFSHQNLKLKWGEGTPKTLSTDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNESTSYK
  FCIQACNEAGEGPLSQEYIFTTPKSVPAALKAPKIEKVNDHICEITWECLQPMKGDPVIY
  SLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTT
  VLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFVIK
• Function: Mediates spermatid-Sertoli adhesion during spermatogenesis.
• Tissue Specificity: Expressed in the odontoblast and nerves in the dental pulp. Also expressed in trachea and to a lesser extent in the brain, liver, lung and kidney.

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[1]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[2]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[3]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Altered Expression	[5]
Lung cancer	DISCM4YA	Strong	Biomarker	[6]
Lung carcinoma	DISTR26C	Strong	Biomarker	[6]
Ocular albinism	DIS5IHK1	Strong	Genetic Variation	[7]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Pervasive developmental disorder	DIS51975	Strong	Genetic Variation	[2]
Peutz-Jeghers syndrome	DISF27ZJ	Strong	Biomarker	[8]
Pheochromocytoma	DIS56IFV	Strong	Biomarker	[9]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[11]
Wilson disease	DISVS9H7	Strong	Genetic Variation	[12]
Retinoschisis	DISTTWND	moderate	Genetic Variation	[13]
Ectodermal dysplasia	DISLRS4M	Disputed	Biomarker	[14]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[11]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[11]
Neoplasm	DISZKGEW	Limited	Altered Expression	[15]
Sclerosing cholangitis	DIS7GZNB	Limited	Genetic Variation	[11]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[11]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Fibronectin type-III domain-containing protein 3A (FNDC3A) affects the response to substance of Mitoxantrone.	[31]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[27]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[28]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[20]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[21]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[22]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[23]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[24]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[22]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[25]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Fibronectin type-III domain-containing protein 3A (FNDC3A).	[30]

References

• [1] MAPT (Tau) expression is a biomarker for an increased rate of survival in pediatric neuroblastoma.Cell Cycle. 2018;17(21-22):2474-2483. doi: 10.1080/15384101.2018.1542898. Epub 2018 Nov 18.
• [2] Associations between single-nucleotide polymorphism in the FNDC3A and autism spectrum disorder in a Korean population.Psychiatry Res. 2013 Sep 30;209(2):246-8. doi: 10.1016/j.psychres.2013.02.028. Epub 2013 Apr 29.
• [3] Association analysis of the dopamine transporter (DAT1)-67A/T polymorphism in bipolar disorder.Am J Med Genet B Neuropsychiatr Genet. 2005 May 5;135B(1):47-9. doi: 10.1002/ajmg.b.30174.
• [4] Mutations of NFKBIA in biopsy specimens from Hodgkin lymphoma.Cancer Genet Cytogenet. 2010 Mar;197(2):152-7. doi: 10.1016/j.cancergencyto.2009.11.005.
• [5] Long Noncoding RNA ASB16-AS1 Promotes Proliferation, Migration, and Invasion in Glioma Cells.Biomed Res Int. 2019 Mar 4;2019:5437531. doi: 10.1155/2019/5437531. eCollection 2019.
• [6] Pattern of antioxidant and DNA repair gene expression in normal airway epithelium associated with lung cancer diagnosis.Cancer Res. 2009 Nov 15;69(22):8629-35. doi: 10.1158/0008-5472.CAN-09-1568. Epub 2009 Nov 3.
• [7] Aberrant splicing in the ocular albinism type 1 gene (OA1/GPR143) is corrected in vitro by morpholino antisense oligonucleotides.Hum Mutat. 2006 May;27(5):420-6. doi: 10.1002/humu.20303.
• [8] Mutations in the human LKB1/STK11 gene.Hum Mutat. 2005 Oct;26(4):291-7. doi: 10.1002/humu.20222.
• [9] Differential expression and processing of secretogranin II in relation to the status of pheochromocytoma: implications for the production of the tumoral marker EM66.J Mol Endocrinol. 2012 Feb 6;48(2):115-27. doi: 10.1530/JME-11-0077. Print 2012 Apr.
• [10] Extensive analysis of the 13q14 region in human prostate tumors: DNA analysis and quantitative expression of genes lying in the interval of deletion.Prostate. 2003 Sep 15;57(1):39-50. doi: 10.1002/pros.10272.
• [11] Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
• [12] Mutation analysis of ATP7B gene in Turkish Wilson disease patients: identification of five novel mutations. Eur J Med Genet. 2013 Apr;56(4):175-9. doi: 10.1016/j.ejmg.2013.01.003. Epub 2013 Jan 17.
• [13] Identification of four novel mutations of the XLRS1 gene in Japanese patients with X-linked juvenile retinoschisis. Mutation in brief no. 234. Online.Hum Mutat. 1999;13(4):338. doi: 10.1002/(SICI)1098-1004(1999)13:4<338::AID-HUMU16>3.0.CO;2-0.
• [14] A novel mutation in NFKBIA/IKBA results in a degradation-resistant N-truncated protein and is associated with ectodermal dysplasia with immunodeficiency. Hum Mutat. 2008 Jun;29(6):861-8. doi: 10.1002/humu.20740.
• [15] Comparative analysis of copy number variations in ulcerative colitis associated and sporadic colorectal neoplasia.BMC Cancer. 2016 Apr 14;16:271. doi: 10.1186/s12885-016-2303-4.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [19] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [22] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [23] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [24] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [25] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [26] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [27] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [28] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [29] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.