Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVJ2CDM)

DOT Name Protein BTG1 (BTG1)
Synonyms B-cell translocation gene 1 protein
Gene Name BTG1
UniProt ID
BTG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07742
Sequence
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEK
PCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGS
ICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
Function Anti-proliferative protein.
KEGG Pathway
R. degradation (hsa03018 )
Reactome Pathway
FOXO-mediated transcription of cell cycle genes (R-HSA-9617828 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
40 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Protein BTG1 (BTG1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein BTG1 (BTG1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Protein BTG1 (BTG1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen affects the expression of Protein BTG1 (BTG1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Protein BTG1 (BTG1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Protein BTG1 (BTG1). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein BTG1 (BTG1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein BTG1 (BTG1). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Protein BTG1 (BTG1). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protein BTG1 (BTG1). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Protein BTG1 (BTG1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Protein BTG1 (BTG1). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protein BTG1 (BTG1). [12]
Marinol DM70IK5 Approved Marinol increases the expression of Protein BTG1 (BTG1). [13]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Protein BTG1 (BTG1). [14]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Protein BTG1 (BTG1). [15]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Protein BTG1 (BTG1). [16]
Aspirin DM672AH Approved Aspirin increases the expression of Protein BTG1 (BTG1). [17]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Protein BTG1 (BTG1). [18]
Malathion DMXZ84M Approved Malathion decreases the expression of Protein BTG1 (BTG1). [19]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Protein BTG1 (BTG1). [20]
Colchicine DM2POTE Approved Colchicine decreases the expression of Protein BTG1 (BTG1). [21]
Adenine DMZLHKJ Approved Adenine decreases the expression of Protein BTG1 (BTG1). [21]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Protein BTG1 (BTG1). [22]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Protein BTG1 (BTG1). [23]
Isoflavone DM7U58J Phase 4 Isoflavone decreases the expression of Protein BTG1 (BTG1). [24]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Protein BTG1 (BTG1). [25]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Protein BTG1 (BTG1). [8]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Protein BTG1 (BTG1). [26]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein BTG1 (BTG1). [28]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Protein BTG1 (BTG1). [29]
Celastrol DMWQIJX Preclinical Celastrol decreases the expression of Protein BTG1 (BTG1). [30]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein BTG1 (BTG1). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Protein BTG1 (BTG1). [31]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Protein BTG1 (BTG1). [32]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Protein BTG1 (BTG1). [33]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Protein BTG1 (BTG1). [34]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone decreases the expression of Protein BTG1 (BTG1). [35]
CATECHIN DMY38SB Investigative CATECHIN increases the expression of Protein BTG1 (BTG1). [36]
N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE DM2D4KY Investigative N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE increases the expression of Protein BTG1 (BTG1). [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein BTG1 (BTG1). [27]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
4 Identification of potential biomarkers of hepatitis B-induced acute liver failure using hepatic cells derived from human skin precursors. Toxicol In Vitro. 2015 Sep;29(6):1231-9. doi: 10.1016/j.tiv.2014.10.012. Epub 2014 Oct 24.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Gene expression profile of multiple myeloma cell line treated by arsenic trioxide. J Huazhong Univ Sci Technolog Med Sci. 2007 Dec;27(6):646-9. doi: 10.1007/s11596-007-0606-z.
12 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
13 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
14 Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
15 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
16 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
17 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
18 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
19 Malathion induced cancer-linked gene expression in human lymphocytes. Environ Res. 2020 Mar;182:109131. doi: 10.1016/j.envres.2020.109131. Epub 2020 Jan 10.
20 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
21 Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
22 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
23 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
24 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
25 Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
26 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
27 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
28 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
29 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
30 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
31 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
32 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
33 Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
34 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
35 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
36 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
37 Immediate up-regulation of the calcium-binding protein S100P and its involvement in the cytokinin-induced differentiation of human myeloid leukemia cells. Biochim Biophys Acta. 2005 Sep 10;1745(2):156-65.