Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVQZMMQ)

• DOT Name: DNA replication complex GINS protein PSF1 (GINS1)
• Synonyms: GINS complex subunit 1
• Gene Name: GINS1
• Related Disease:
  Hepatocellular carcinoma
  Advanced cancer
  Ankylosing spondylitis
  Breast cancer
  Breast carcinoma
  Colon carcinoma
  Fetal growth restriction
  Leukopenia
  Non-small-cell lung cancer
  Synovial sarcoma
  Lung cancer
  Lung carcinoma
  Neoplasm
  Combined immunodeficiency due to GINS1 deficiency
  Prostate cancer
  Prostate carcinoma
• UniProt ID: PSF1_HUMAN
• PDB ID: 2E9X; 2EHO; 2Q9Q; 6XTX; 6XTY; 7PFO; 7PLO; 8B9D
• Pfam ID: PF05916
• Sequence:
  MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIP
  TIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRS
  LATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
  KCEQLIRQGVLEHILS
• Function: Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built.
• Reactome Pathway: Unwinding of DNA (R-HSA-176974)

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[4]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[5]
Fetal growth restriction	DIS5WEJ5	Strong	Biomarker	[6]
Leukopenia	DISJMBMM	Strong	Biomarker	[6]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[7]
Synovial sarcoma	DISEZJS7	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	moderate	Biomarker	[9]
Lung carcinoma	DISTR26C	moderate	Biomarker	[9]
Neoplasm	DISZKGEW	moderate	Biomarker	[2]
Combined immunodeficiency due to GINS1 deficiency	DIS1OXUF	Supportive	Autosomal recessive	[6]
Prostate cancer	DISF190Y	Limited	Altered Expression	[10]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[10]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[11]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[13]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[15]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[16]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[17]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[17]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[18]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[19]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[20]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[21]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[22]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[24]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[25]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[16]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[26]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[27]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[28]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[29]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[32]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[25]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of DNA replication complex GINS protein PSF1 (GINS1).	[33]

References

• [1] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [2] Soluble HLA-associated peptide from PSF1 has a cancer vaccine potency.Sci Rep. 2017 Sep 11;7(1):11137. doi: 10.1038/s41598-017-11605-2.
• [3] Allelic variants of the human putative peptide transporter involved in antigen processing.Proc Natl Acad Sci U S A. 1992 May 1;89(9):3932-6. doi: 10.1073/pnas.89.9.3932.
• [4] RNA-sequence-based microRNA expression signature in breast cancer: tumor-suppressive miR-101-5p regulates molecular pathogenesis.Mol Oncol. 2020 Feb;14(2):426-446. doi: 10.1002/1878-0261.12602. Epub 2019 Dec 29.
• [5] PSF1, a DNA replication factor expressed widely in stem and progenitor cells, drives tumorigenic and metastatic properties.Cancer Res. 2010 Feb 1;70(3):1215-24. doi: 10.1158/0008-5472.CAN-09-3662. Epub 2010 Jan 26.
• [6] Inherited GINS1 deficiency underlies growth retardation along with neutropenia and NK cell deficiency. J Clin Invest. 2017 May 1;127(5):1991-2006. doi: 10.1172/JCI90727. Epub 2017 Apr 17.
• [7] PSF1 (Partner of SLD Five 1) is a Prognostic Biomarker in Patients with Non-small Cell Lung Cancer Treated with Surgery Following Preoperative Chemotherapy or Chemoradiotherapy.Ann Surg Oncol. 2016 Nov;23(12):4093-4100. doi: 10.1245/s10434-016-5392-z. Epub 2016 Jul 5.
• [8] Anlotinib inhibits synovial sarcoma by targeting GINS1: a novel downstream target oncogene in progression of synovial sarcoma.Clin Transl Oncol. 2019 Dec;21(12):1624-1633. doi: 10.1007/s12094-019-02090-2. Epub 2019 Apr 8.
• [9] Knockdown of PSF1 expression inhibits cell proliferation in lung cancer cells in vitro.Tumour Biol. 2015 Mar;36(3):2163-8. doi: 10.1007/s13277-014-2826-8. Epub 2014 Nov 15.
• [10] Evaluation of PSF1 as a prognostic biomarker for prostate cancer.Prostate Cancer Prostatic Dis. 2015 Mar;18(1):56-62. doi: 10.1038/pcan.2014.46. Epub 2014 Nov 18.
• [11] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [12] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [13] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [14] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [17] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [18] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [19] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [20] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [21] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [22] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [23] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [26] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [27] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [28] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [29] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [30] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [33] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.