Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVT3SEJ)

DOT Name Matrilysin (MMP7)
Synonyms EC 3.4.24.23; Matrin; Matrix metalloproteinase-7; MMP-7; Pump-1 protease; Uterine metalloproteinase
Gene Name MMP7
UniProt ID
MMP7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1MMP; 1MMQ; 1MMR; 2DDY; 2MZE; 2MZH; 2MZI; 2Y6C; 2Y6D; 5UE2; 5UE5; 7WXX; 8JUD; 8JUF; 8JUG
EC Number
3.4.24.23
Pfam ID
PF00413 ; PF01471
Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Function Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
KEGG Pathway
Wnt sig.ling pathway (hsa04310 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Reactome Pathway
Degradation of the extracellular matrix (R-HSA-1474228 )
Activation of Matrix Metalloproteinases (R-HSA-1592389 )
Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Collagen degradation (R-HSA-1442490 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
39 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Matrilysin (MMP7). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Matrilysin (MMP7). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Matrilysin (MMP7). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Matrilysin (MMP7). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Matrilysin (MMP7). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Matrilysin (MMP7). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Matrilysin (MMP7). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Matrilysin (MMP7). [9]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Matrilysin (MMP7). [10]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Matrilysin (MMP7). [11]
Nicotine DMWX5CO Approved Nicotine increases the expression of Matrilysin (MMP7). [12]
Clozapine DMFC71L Approved Clozapine decreases the expression of Matrilysin (MMP7). [13]
Permethrin DMZ0Q1G Approved Permethrin increases the expression of Matrilysin (MMP7). [14]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the expression of Matrilysin (MMP7). [15]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the expression of Matrilysin (MMP7). [16]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Matrilysin (MMP7). [17]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the expression of Matrilysin (MMP7). [18]
Propofol DMB4OLE Approved Propofol increases the expression of Matrilysin (MMP7). [19]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone decreases the expression of Matrilysin (MMP7). [20]
Glyceryl trinitrate DMF72W3 Phase 4 Glyceryl trinitrate increases the expression of Matrilysin (MMP7). [21]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Matrilysin (MMP7). [22]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Matrilysin (MMP7). [23]
HMPL-004 DM29XGY Phase 3 HMPL-004 decreases the expression of Matrilysin (MMP7). [24]
EXISULIND DMBY56U Phase 3 EXISULIND decreases the expression of Matrilysin (MMP7). [7]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the expression of Matrilysin (MMP7). [25]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Matrilysin (MMP7). [20]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Matrilysin (MMP7). [26]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Matrilysin (MMP7). [27]
AMEP DMFELMQ Phase 1 AMEP decreases the expression of Matrilysin (MMP7). [28]
Nobiletin DM7R3B6 Preclinical Nobiletin decreases the expression of Matrilysin (MMP7). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Matrilysin (MMP7). [29]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Matrilysin (MMP7). [30]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Matrilysin (MMP7). [31]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of Matrilysin (MMP7). [22]
MANGIFERIN DMWAF5Z Investigative MANGIFERIN decreases the expression of Matrilysin (MMP7). [33]
Beta-D-Glucose DM5IHYP Investigative Beta-D-Glucose increases the expression of Matrilysin (MMP7). [34]
Isoarnebin 4 DM0B7NO Investigative Isoarnebin 4 decreases the expression of Matrilysin (MMP7). [35]
(E)-10-nitrooctadec-9-enoic acid DMTF7JA Investigative (E)-10-nitrooctadec-9-enoic acid increases the activity of Matrilysin (MMP7). [36]
[3H]mibolerone DM6HDKQ Investigative [3H]mibolerone decreases the expression of Matrilysin (MMP7). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Drug(s)
3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol increases the secretion of Matrilysin (MMP7). [6]
Progesterone DMUY35B Approved Progesterone decreases the secretion of Matrilysin (MMP7). [6]
acrolein DMAMCSR Investigative acrolein increases the secretion of Matrilysin (MMP7). [32]
------------------------------------------------------------------------------------

References

1 Effect of mood stabilizers on gene expression in lymphoblastoid cells. J Neural Transm (Vienna). 2010 Feb;117(2):155-64.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Reduced expression of progesterone receptor-B in the endometrium of women with endometriosis and in cocultures of endometrial cells exposed to 2,3,7,8-tetrachlorodibenzo-p-dioxin. Fertil Steril. 2005 Jul;84(1):67-74. doi: 10.1016/j.fertnstert.2005.01.113.
7 Nobiletin, a citrus flavonoid, down-regulates matrix metalloproteinase-7 (matrilysin) expression in HT-29 human colorectal cancer cells. Biosci Biotechnol Biochem. 2005 Feb;69(2):307-14. doi: 10.1271/bbb.69.307.
8 Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
9 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
10 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
11 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
12 Activation of 5-lipoxygenase is required for nicotine mediated epithelial-mesenchymal transition and tumor cell growth. Cancer Lett. 2010 Jun 28;292(2):237-45.
13 Histamine H4 receptor agonists have more activities than H4 agonism in antigen-specific human T-cell responses. Immunology. 2007 Jun;121(2):266-75. doi: 10.1111/j.1365-2567.2007.02574.x. Epub 2007 Mar 7.
14 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
15 The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
16 AMPK-dependent signaling modulates the suppression of invasion and migration by fenofibrate in CAL 27 oral cancer cells through NF-B pathway. Environ Toxicol. 2016 Jul;31(7):866-76. doi: 10.1002/tox.22097. Epub 2014 Dec 24.
17 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
18 Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
19 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
20 Androgen receptor-Ets protein interaction is a novel mechanism for steroid hormone-mediated down-modulation of matrix metalloproteinase expression. J Biol Chem. 1996 Sep 27;271(39):23907-13. doi: 10.1074/jbc.271.39.23907.
21 Nitroglycerin upregulates matrix metalloproteinase expression by human macrophages. J Am Coll Cardiol. 2002 Jun 19;39(12):1943-50. doi: 10.1016/s0735-1097(02)01907-1.
22 Resveratrol inhibits invasion and metastasis of colorectal cancer cells via MALAT1 mediated Wnt/-catenin signal pathway. PLoS One. 2013 Nov 11;8(11):e78700. doi: 10.1371/journal.pone.0078700. eCollection 2013.
23 Modifying effects of dietary factors on (-)-epigallocatechin-3-gallate-induced pro-matrix metalloproteinase-7 production in HT-29 human colorectal cancer cells. Biosci Biotechnol Biochem. 2007 Oct;71(10):2442-50. doi: 10.1271/bbb.70213. Epub 2007 Oct 7.
24 Andrographolide could inhibit human colorectal carcinoma Lovo cells migration and invasion via down-regulation of MMP-7 expression. Chem Biol Interact. 2009 Aug 14;180(3):344-52. doi: 10.1016/j.cbi.2009.04.011. Epub 2009 May 6.
25 Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
26 Effect of benzo[a]pyrene on proliferation and metastasis of oral squamous cell carcinoma cells: A transcriptome analysis based on RNA-seq. Environ Toxicol. 2022 Nov;37(11):2589-2604. doi: 10.1002/tox.23621. Epub 2022 Jul 23.
27 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
28 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
29 Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
30 Deguelin inhibits the migration and invasion of U-2 OS human osteosarcoma cells via the inhibition of matrix metalloproteinase-2/-9 in vitro. Molecules. 2014 Oct 15;19(10):16588-608.
31 Gallic acid inhibits migration and invasion in human osteosarcoma U-2 OS cells through suppressing the matrix metalloproteinase-2/-9, protein kinase B (PKB) and PKC signaling pathways. Food Chem Toxicol. 2012 May;50(5):1734-40. doi: 10.1016/j.fct.2012.02.033. Epub 2012 Feb 25.
32 Evaluating Mode of Action of Acrolein Toxicity in an In Vitro Human Airway Tissue Model. Toxicol Sci. 2018 Dec 1;166(2):451-464. doi: 10.1093/toxsci/kfy226.
33 Mangiferin exerts antitumor activity in breast cancer cells by regulating matrix metalloproteinases, epithelial to mesenchymal transition, and -catenin signaling pathway. Toxicol Appl Pharmacol. 2013 Oct 1;272(1):180-90. doi: 10.1016/j.taap.2013.05.011. Epub 2013 May 22.
34 Regulation and possible function of beta-catenin in human monocytes. J Immunol. 2001 Dec 15;167(12):6786-93. doi: 10.4049/jimmunol.167.12.6786.
35 Shikonin suppresses small cell lung cancer growth via inducing ATF3-mediated ferroptosis to promote ROS accumulation. Chem Biol Interact. 2023 Sep 1;382:110588. doi: 10.1016/j.cbi.2023.110588. Epub 2023 Jun 1.
36 Electrophilic fatty acids regulate matrix metalloproteinase activity and expression. J Biol Chem. 2011 May 6;286(18):16074-81. doi: 10.1074/jbc.M111.225029. Epub 2011 Mar 15.