Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWURB8U)

• DOT Name: Plastin-1 (PLS1)
• Synonyms: Intestine-specific plastin; I-plastin
• Gene Name: PLS1
• Related Disease:
  Lung adenocarcinoma
  Deafness
  Hearing loss, autosomal dominant 76
  Influenza
  Liver cancer
  Motor neurone disease
  Neoplasm
  Autosomal dominant nonsyndromic hearing loss
• UniProt ID: PLSI_HUMAN
• Pfam ID: PF00307 ; PF13499
• Sequence:
  MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
  SVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
  SEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDER
  AINKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFA
  DIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDIKDSRA
  YFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVVSGN
  PKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD
  LADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIA
  GQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSIS
  SFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYA
  LPDDLVEVKPKMVMTVFACLMGKGLNRIK
• Function: Actin-bundling protein. In the inner ear, it is required for stereocilia formation. Mediates liquid packing of actin filaments that is necessary for stereocilia to grow to their proper dimensions.
• Tissue Specificity: In small intestine, colon, and kidney; relatively lower levels of expression are detected in the lung and stomach.
• Reactome Pathway:
  Sensory processing of sound by outer hair cells of the cochlea (R-HSA-9662361)
  Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360)

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Deafness	DISKCLH4	Strong	Genetic Variation	[2]
Hearing loss, autosomal dominant 76	DISOQSLN	Strong	Autosomal dominant	[3]
Influenza	DIS3PNU3	Strong	Biomarker	[4]
Liver cancer	DISDE4BI	Strong	Biomarker	[5]
Motor neurone disease	DISUHWUI	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Autosomal dominant nonsyndromic hearing loss	DISYC1G0	Supportive	Autosomal dominant	[3]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Plastin-1 (PLS1).	[8]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Plastin-1 (PLS1).	[9]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Plastin-1 (PLS1).	[10]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Plastin-1 (PLS1).	[11]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Plastin-1 (PLS1).	[12]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Plastin-1 (PLS1).	[13]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Plastin-1 (PLS1).	[15]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Plastin-1 (PLS1).	[16]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Plastin-1 (PLS1).	[17]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Plastin-1 (PLS1).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Plastin-1 (PLS1).	[19]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Plastin-1 (PLS1).	[20]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Plastin-1 (PLS1).	[21]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Plastin-1 (PLS1).	[22]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Plastin-1 (PLS1).	[23]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Plastin-1 (PLS1).	[24]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Plastin-1 (PLS1).	[23]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Plastin-1 (PLS1).	[26]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Plastin-1 (PLS1).	[27]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Plastin-1 (PLS1).	[28]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Plastin-1 (PLS1).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Plastin-1 (PLS1).	[25]

References

• [1] Meta-analysis of oncogenic protein kinase Ciota signaling in lung adenocarcinoma.Clin Cancer Res. 2009 Mar 1;15(5):1527-33. doi: 10.1158/1078-0432.CCR-08-2459. Epub 2009 Feb 17.
• [2] Hearing impairment locus heterogeneity and identification of PLS1 as a new autosomal dominant gene in Hungarian Roma. Eur J Hum Genet. 2019 Jun;27(6):869-878. doi: 10.1038/s41431-019-0372-y. Epub 2019 Mar 14.
• [3] Mutations in PLS1, encoding fimbrin, cause autosomal dominant nonsyndromic hearing loss. Hum Mutat. 2019 Dec;40(12):2286-2295. doi: 10.1002/humu.23891. Epub 2019 Oct 1.
• [4] Nucleotide sequences of genes coding for fimbrial proteins in a cryptic genospecies of Haemophilus spp. isolated from neonatal and genital tract infections.Infect Immun. 1999 Jan;67(1):8-15. doi: 10.1128/IAI.67.1.8-15.1999.
• [5] A comparison of transcriptomic and metabonomic technologies for identifying biomarkers predictive of two-year rodent cancer bioassays.Toxicol Sci. 2007 Mar;96(1):40-6. doi: 10.1093/toxsci/kfl171. Epub 2006 Nov 17.
• [6] A locus for primary lateral sclerosis on chromosome 4ptel-4p16.1.Arch Neurol. 2008 Mar;65(3):383-6. doi: 10.1001/archneur.65.3.383.
• [7] Evaluation of liver parenchyma stiffness in patients with liver tumours: optimal strategy for shear wave elastography.Eur Radiol. 2019 Mar;29(3):1479-1488. doi: 10.1007/s00330-018-5676-8. Epub 2018 Aug 13.
• [8] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [10] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [11] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [12] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.
• [13] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [14] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [15] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [16] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [17] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [18] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [19] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [20] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [21] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [22] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [23] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [24] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [25] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [26] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [27] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [28] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.